F224932

General Info

Members Datasets Scaffolds Average Seq Length
156 103 128 148

Family's Representative Sequence

Representative Sequence 3300020081|Ga0206354_10327087|Ga0206354_103270872
Length 170
Sequence VSPIPTPPTGWQAAAERAVAHGRTLDRFIPSILLDSPASGVGYAYGTAVGWIWGGLWSTGRVEKRGELWVFRGLPSWAFKRGGICVGGCYLTGDAVVTDRVLAHEAVHARQWRRYGLLMPLLYLFAGRDPLRNRFEIEAGLEDGNYVPRQKAARPTGAVSSARPSTAQSR

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221553 Microbacterium sp. Root553 Isolate Unclassified
4 2643221566 Microbacterium sp. Root166 Isolate Unclassified
5 2643221597 Microbacterium sp. Root180 Isolate Unclassified
6 2643221630 Microbacterium sp. Root322 Isolate Unclassified
7 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
8 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
9 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
10 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
11 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
12 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
13 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
14 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
15 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
16 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
17 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
18 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
19 2919395869 Microbacterium resistens 2980 Isolate Unclassified
20 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
21 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
22 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
23 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
24 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
25 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
26 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
43 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
48 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
52 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
53 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
54 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
55 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
56 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
57 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
58 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
64 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
65 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
66 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
67 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
68 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
69 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
70 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
71 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
72 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
73 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
74 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
75 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
76 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
77 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
78 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
79 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
83 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
84 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
85 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
86 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
87 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
88 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
89 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
90 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
95 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
96 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
97 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
98 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
99 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
101 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
102 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
103 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80.13
Metatranscriptomes 1.92
Isolates 17.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.18
Nodule 0
Rhizoplane 14.74
Rhizosphere 33.97
Stem 0
Stem Tuber 0
Unclassified 39.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10017451 3300001979 Bacteria 2567
2 JGI25154J39366_1001941 3300002738 Bacteria 6165
3 rootH2_10104023 3300003320 Bacteria 1868
4 Ga0006562J51391_1056185 3300003578 Bacteria 3320
5 Ga0075365_10002202 3300006038 Bacteria 9402
6 Ga0075363_100015615 3300006048 Bacteria 3736
7 Ga0075363_100572879 3300006048 Bacteria 675
8 Ga0075364_10016761 3300006051 Bacteria 4564
9 Ga0075364_10056497 3300006051 Bacteria 2570
10 Ga0075364_10218781 3300006051 Bacteria 1292
11 Ga0075364_10275758 3300006051 Bacteria 1144
12 Ga0075364_10299303 3300006051 Bacteria 1095
13 Ga0075367_10009449 3300006178 Bacteria 5097
14 Ga0075369_10080060 3300006186 Bacteria 1448
15 Ga0105244_10162712 3300009036 Bacteria 1065
16 Ga0105243_10031728 3300009148 Bacteria 4075
17 Ga0105237_10067496 3300009545 Bacteria 3570
18 Ga0157369_10214116 3300013105 Bacteria 2019
19 Ga0171462_1001 3300013250 Bacteria 1135406
20 Ga0163162_10028888 3300013306 Bacteria 5488
21 Ga0157372_10243662 3300013307 Bacteria 2086
22 Ga0206354_10327087 3300020081 Bacteria 1255
23 Ga0209646_1000134 3300025246 Bacteria 124492
24 Ga0207655_1047905 3300025728 Bacteria 1759
25 Ga0207655_1090762 3300025728 Bacteria 1076
26 Ga0207709_10015922 3300025935 Bacteria 4173
27 Ga0207683_11585008 3300026121 Bacteria 604
28 Ga0307413_10304059 3300031824 Bacteria 1211
29 Ga0307406_10000025 3300031901 Bacteria 92128
30 Ga0307406_10000955 3300031901 Bacteria 16163
31 Ga0307406_10010693 3300031901 Bacteria 5183
32 Ga0307406_10028886 3300031901 Bacteria 3354
33 Ga0307406_10363888 3300031901 Bacteria 1135
34 Ga0307406_11261022 3300031901 Bacteria 644
35 Ga0307412_10139725 3300031911 Bacteria 1772
36 Ga0307409_101011163 3300031995 Bacteria 850
37 Ga0307416_100309625 3300032002 Bacteria 1575
38 Ga0307414_10004620 3300032004 Bacteria 7491
39 Ga0307414_10139509 3300032004 Bacteria 1896
40 Ga0307414_10558651 3300032004 Bacteria 1021
41 Ga0451791_0642209 3300041451 Bacteria 519
42 Ga0451837_0271138 3300041494 Bacteria 1128
43 Ga0451841_1278020 3300041498 Bacteria 1195
44 Ga0451843_0777373 3300041509 Bacteria 561
45 Ga0451855_1970166 3300041511 Bacteria 710
46 Ga0451853_0838337 3300041512 Bacteria 1202
47 Ga0451853_2361289 3300041512 Bacteria 632
48 Ga0466965_0140756 3300044683 Bacteria 1256
49 Ga0466970_0000835 3300044765 Bacteria 14806
50 Ga0466957_0024556 3300044842 Bacteria 3567
51 Ga0466960_0595029 3300044901 Bacteria 656
52 Ga0466967_0084466 3300045976 Bacteria 2873
53 Ga0495627_000588 3300046453 Bacteria 29097
54 Ga0495620_0194727 3300046515 Bacteria 781
55 Ga0495632_0346357 3300046519 Bacteria 654
56 Ga0495648_0489416 3300046524 Bacteria 530
57 Ga0496100_0004189 3300048903 Bacteria 7606
58 Ga0496101_0159687 3300048904 Bacteria 1728
59 Ga0496102_0032638 3300048905 Bacteria 4678
60 Ga0496103_0011344 3300048906 Bacteria 5278
61 Ga0496103_0053759 3300048906 Bacteria 2496
62 Ga0496104_0036857 3300048907 Bacteria 4572
63 Ga0496104_0241629 3300048907 Bacteria 1718
64 Ga0496104_0834106 3300048907 Bacteria 827
65 Ga0496105_0123504 3300048908 Bacteria 2134
66 Ga0496105_0374086 3300048908 Bacteria 1134
67 Ga0496107_0004498 3300048910 Bacteria 9457
68 Ga0496108_0701880 3300048911 Bacteria 877
69 Ga0496109_0022888 3300048912 Bacteria 5538
70 Ga0496110_0113464 3300048913 Bacteria 2437
71 Ga0496111_0013028 3300048914 Bacteria 5645
72 Ga0496112_0316458 3300048915 Bacteria 1505
73 Ga0496113_0011890 3300048916 Bacteria 5833
74 Ga0496113_0138722 3300048916 Bacteria 1912
75 Ga0496114_0014564 3300048917 Bacteria 6317
76 Ga0496114_0202533 3300048917 Bacteria 1739
77 Ga0496115_0010422 3300048918 Bacteria 6944
78 Ga0496115_0109527 3300048918 Bacteria 2268
79 Ga0496117_0001188 3300048920 Bacteria 39155
80 Ga0496117_0001743 3300048920 Bacteria 30010
81 Ga0496117_0023259 3300048920 Bacteria 4945
82 Ga0496117_0109895 3300048920 Bacteria 1720
83 Ga0496118_0019713 3300048921 Bacteria 6016
84 Ga0496118_0045833 3300048921 Bacteria 3407
85 Ga0496118_0050005 3300048921 Bacteria 3213
86 Ga0496119_0003102 3300048922 Bacteria 17539
87 Ga0496119_0015395 3300048922 Bacteria 5893
88 Ga0496119_0071169 3300048922 Bacteria 2037
89 Ga0496120_0001547 3300048923 Bacteria 26928
90 Ga0496120_0018361 3300048923 Bacteria 4511
91 Ga0496122_0000948 3300048925 Bacteria 52491
92 Ga0496122_0035782 3300048925 Bacteria 4031
93 Ga0496122_0056788 3300048925 Bacteria 2914
94 Ga0496122_0287957 3300048925 Bacteria 894
95 Ga0496122_0427346 3300048925 Bacteria 664
96 Ga0496123_0000169 3300048926 Bacteria 130983
97 Ga0496123_0141809 3300048926 Bacteria 1312
98 Ga0496123_0148607 3300048926 Bacteria 1268
99 Ga0496124_0016125 3300048927 Bacteria 7127
100 Ga0496124_0613760 3300048927 Bacteria 705
101 Ga0496124_0757652 3300048927 Bacteria 607
102 Ga0496125_0004022 3300048928 Bacteria 17256
103 Ga0496125_0046258 3300048928 Bacteria 3652
104 Ga0496125_0063948 3300048928 Bacteria 2929
105 Ga0496125_0091205 3300048928 Bacteria 2284
106 Ga0496125_0147325 3300048928 Bacteria 1624
107 Ga0496125_0317383 3300048928 Bacteria 946
108 Ga0496126_0011010 3300048929 Bacteria 9409
109 Ga0496126_0093458 3300048929 Bacteria 2641
110 Ga0496126_0100824 3300048929 Bacteria 2526
111 Ga0496126_0102884 3300048929 Bacteria 2496
112 Ga0496126_0160941 3300048929 Bacteria 1918
113 Ga0496126_0247932 3300048929 Bacteria 1485
114 Ga0496126_0493971 3300048929 Bacteria 979
115 Ga0501034_0000909 3300049571 Bacteria 43164
116 Ga0501038_0003027 3300049574 Bacteria 15678
117 Ga0501038_0006708 3300049574 Bacteria 10640
118 Ga0501070_0002782 3300049586 Bacteria 15266
119 nmdc:mga03n38_37786_c1 3300050490 Bacteria 2085
120 nmdc:mga00v17_100695_c1 3300050491 Bacteria 1823
121 nmdc:mga00v17_135618_c1 3300050491 Bacteria 685
122 nmdc:mga00v17_2907_c1 3300050491 Bacteria 8784
123 nmdc:mga0yw44_11754_c1 3300050492 Bacteria 4537
124 nmdc:mga0yw44_448073_c1 3300050492 Bacteria 875
125 nmdc:mga0sz30_336375_c1 3300050516 Bacteria 674
126 nmdc:mga0sz30_548574_c1 3300050516 Bacteria 521
127 Ga0500593_172952 3300053117 Bacteria 811
128 Ga0587084_042264 3300059477 Bacteria 779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046515 Ga0495620_0194727 Ga0495620_0194727_75_491 129
2 iso_pu_bacteria 2808606447 2809226867 129
3 iso_pu_bacteria 2852632344 2852633087 129
4 3300048920 Ga0496117_0001743 Ga0496117_0001743_13003_13425 132
5 3300048922 Ga0496119_0003102 Ga0496119_0003102_3102_3524 132
6 3300048923 Ga0496120_0018361 Ga0496120_0018361_330_752 132
7 3300048925 Ga0496122_0000948 Ga0496122_0000948_23688_24110 132
8 3300048926 Ga0496123_0000169 Ga0496123_0000169_84056_84478 132
9 3300048927 Ga0496124_0016125 Ga0496124_0016125_5640_6062 132
10 3300048928 Ga0496125_0063948 Ga0496125_0063948_557_979 132
11 3300048929 Ga0496126_0011010 Ga0496126_0011010_5959_6381 132
12 3300031824 Ga0307413_10304059 Ga0307413_103040592 137
13 3300002738 JGI25154J39366_1001941 JGI25154J39366_10019417 139
14 3300025246 Ga0209646_1000134 Ga0209646_100013494 139
15 3300049574 Ga0501038_0003027 Ga0501038_0003027_828_1310 139
16 3300059477 Ga0587084_042264 Ga0587084_042264_99_581 139
17 iso_pu_bacteria 2643221553 2643785327 140
18 iso_pu_bacteria 2643221724 2644679664 140
19 iso_pu_bacteria 2728369380 2730229174 140
20 iso_pu_bacteria 2747842429 2747954219 140
21 iso_pu_bacteria 2852646457 2852646917 140
22 iso_pu_bacteria 2857723135 2857723363 140
23 iso_pu_bacteria 2945968032 2945971368 140
24 iso_pu_bacteria 2946033335 2946034228 140
25 iso_pu_bacteria 2946041624 2946043699 140
26 iso_pu_bacteria 2946080515 2946081386 140
27 3300009545 Ga0105237_10067496 Ga0105237_100674962 141
28 3300013105 Ga0157369_10214116 Ga0157369_102141163 141
29 3300013306 Ga0163162_10028888 Ga0163162_100288882 141
30 3300013307 Ga0157372_10243662 Ga0157372_102436623 141
31 3300048903 Ga0496100_0004189 Ga0496100_0004189_4684_5109 141
32 3300048905 Ga0496102_0032638 Ga0496102_0032638_1949_2374 141
33 3300048906 Ga0496103_0011344 Ga0496103_0011344_1404_1829 141
34 3300048907 Ga0496104_0834106 Ga0496104_0834106_299_724 141
35 3300048908 Ga0496105_0374086 Ga0496105_0374086_411_836 141
36 3300048910 Ga0496107_0004498 Ga0496107_0004498_4034_4459 141
37 3300048911 Ga0496108_0701880 Ga0496108_0701880_211_636 141
38 3300048912 Ga0496109_0022888 Ga0496109_0022888_5000_5425 141
39 3300048913 Ga0496110_0113464 Ga0496110_0113464_1832_2257 141
40 3300048914 Ga0496111_0013028 Ga0496111_0013028_4985_5410 141
41 3300048915 Ga0496112_0316458 Ga0496112_0316458_209_634 141
42 3300048916 Ga0496113_0011890 Ga0496113_0011890_2141_2566 141
43 3300048917 Ga0496114_0014564 Ga0496114_0014564_618_1043 141
44 3300048917 Ga0496114_0202533 Ga0496114_0202533_176_601 141
45 3300048918 Ga0496115_0010422 Ga0496115_0010422_5345_5770 141
46 3300048904 Ga0496101_0159687 Ga0496101_0159687_893_1342 142
47 3300048906 Ga0496103_0053759 Ga0496103_0053759_601_1050 142
48 3300048907 Ga0496104_0036857 Ga0496104_0036857_1034_1483 142
49 3300048922 Ga0496119_0071169 Ga0496119_0071169_1543_2010 142
50 iso_pu_bacteria 2643221542 2643734140 142
51 iso_pu_bacteria 2643221630 2644170726 142
52 iso_pu_bacteria 2852663356 2852664747 142
53 iso_pu_bacteria 8004182704 8004185591 142
54 3300003320 rootH2_10104023 rootH2_101040233 144
55 3300006048 Ga0075363_100572879 Ga0075363_1005728792 144
56 3300006051 Ga0075364_10016761 Ga0075364_100167616 144
57 3300006051 Ga0075364_10056497 Ga0075364_100564973 144
58 3300006051 Ga0075364_10218781 Ga0075364_102187813 144
59 3300006051 Ga0075364_10275758 Ga0075364_102757582 144
60 3300031901 Ga0307406_10000955 Ga0307406_1000095512 144
61 3300031901 Ga0307406_10010693 Ga0307406_100106933 144
62 3300031901 Ga0307406_10363888 Ga0307406_103638881 144
63 3300031911 Ga0307412_10139725 Ga0307412_101397252 144
64 3300032004 Ga0307414_10004620 Ga0307414_100046202 144
65 3300032004 Ga0307414_10139509 Ga0307414_101395093 144
66 3300041451 Ga0451791_0642209 Ga0451791_0642209_28_483 144
67 3300041494 Ga0451837_0271138 Ga0451837_0271138_165_608 144
68 3300041498 Ga0451841_1278020 Ga0451841_1278020_70_507 144
69 3300041509 Ga0451843_0777373 Ga0451843_0777373_85_522 144
70 3300041511 Ga0451855_1970166 Ga0451855_1970166_255_692 144
71 3300041512 Ga0451853_0838337 Ga0451853_0838337_112_570 144
72 3300048920 Ga0496117_0001188 Ga0496117_0001188_31606_32043 144
73 3300048920 Ga0496117_0109895 Ga0496117_0109895_601_1038 144
74 3300048921 Ga0496118_0045833 Ga0496118_0045833_1471_1908 144
75 3300048925 Ga0496122_0035782 Ga0496122_0035782_3201_3638 144
76 3300048925 Ga0496122_0427346 Ga0496122_0427346_112_549 144
77 3300048926 Ga0496123_0148607 Ga0496123_0148607_220_657 144
78 3300048927 Ga0496124_0613760 Ga0496124_0613760_188_625 144
79 3300048928 Ga0496125_0004022 Ga0496125_0004022_13779_14216 144
80 3300048928 Ga0496125_0046258 Ga0496125_0046258_2357_2794 144
81 3300048928 Ga0496125_0147325 Ga0496125_0147325_974_1411 144
82 3300048929 Ga0496126_0100824 Ga0496126_0100824_411_848 144
83 3300048929 Ga0496126_0102884 Ga0496126_0102884_1228_1665 144
84 3300048929 Ga0496126_0160941 Ga0496126_0160941_640_1077 144
85 3300048929 Ga0496126_0247932 Ga0496126_0247932_836_1315 144
86 3300049571 Ga0501034_0000909 Ga0501034_0000909_7733_8194 144
87 3300049574 Ga0501038_0006708 Ga0501038_0006708_3493_3933 144
88 3300050491 nmdc:mga00v17_100695_c1 nmdc:mga00v17_100695_c1_1206_1643 144
89 3300050491 nmdc:mga00v17_135618_c1 nmdc:mga00v17_135618_c1_226_663 144
90 3300050491 nmdc:mga00v17_2907_c1 nmdc:mga00v17_2907_c1_7924_8361 144
91 iso_pu_bacteria 2870628048 2870629769 144
92 iso_pu_bacteria 2919395869 2919396876 144
93 iso_pu_bacteria 8004212874 8004214632 144
94 iso_pu_bacteria 2585428157 2588106704 145
95 3300046453 Ga0495627_000588 Ga0495627_000588_16012_16455 146
96 3300048928 Ga0496125_0317383 Ga0496125_0317383_270_713 146
97 3300048929 Ga0496126_0493971 Ga0496126_0493971_238_681 146
98 iso_pu_bacteria 2643221566 2643849416 146
99 iso_pu_bacteria 2643221597 2643996404 146
100 iso_pu_bacteria 2757320536 2758224393 146
101 iso_pu_bacteria 2808606306 2808631704 146
102 iso_pu_bacteria 2811994872 2812322484 146
103 iso_pu_bacteria 2928090899 2928091231 146
104 iso_pu_bacteria 8016254467 8016254666 146
105 iso_pu_bacteria 8045830549 8045832680 146
106 3300003578 Ga0006562J51391_1056185 Ga0006562J51391_10561855 148
107 3300006038 Ga0075365_10002202 Ga0075365_100022024 148
108 3300006048 Ga0075363_100015615 Ga0075363_1000156154 148
109 3300006051 Ga0075364_10299303 Ga0075364_102993031 148
110 3300006178 Ga0075367_10009449 Ga0075367_100094495 148
111 3300009036 Ga0105244_10162712 Ga0105244_101627122 148
112 3300009148 Ga0105243_10031728 Ga0105243_100317283 148
113 3300025728 Ga0207655_1047905 Ga0207655_10479053 148
114 3300025728 Ga0207655_1090762 Ga0207655_10907622 148
115 3300025935 Ga0207709_10015922 Ga0207709_100159225 148
116 3300031901 Ga0307406_10000025 Ga0307406_1000002548 148
117 3300046519 Ga0495632_0346357 Ga0495632_0346357_133_585 148
118 3300046524 Ga0495648_0489416 Ga0495648_0489416_35_493 148
119 3300050490 nmdc:mga03n38_37786_c1 nmdc:mga03n38_37786_c1_52_516 148
120 3300050492 nmdc:mga0yw44_11754_c1 nmdc:mga0yw44_11754_c1_3141_3605 148
121 3300050516 nmdc:mga0sz30_548574_c1 nmdc:mga0sz30_548574_c1_27_491 148
122 3300053117 Ga0500593_172952 Ga0500593_172952_80_568 148
123 3300006186 Ga0075369_10080060 Ga0075369_100800603 149
124 3300048921 Ga0496118_0050005 Ga0496118_0050005_479_952 149
125 3300050492 nmdc:mga0yw44_448073_c1 nmdc:mga0yw44_448073_c1_347_802 149
126 3300050516 nmdc:mga0sz30_336375_c1 nmdc:mga0sz30_336375_c1_178_633 149
127 3300013250 Ga0171462_1001 Ga0171462_1001222 150
128 3300020081 Ga0206354_10327087 Ga0206354_103270872 150
129 3300026121 Ga0207683_11585008 Ga0207683_115850082 150
130 3300031901 Ga0307406_10028886 Ga0307406_100288864 150
131 3300031901 Ga0307406_11261022 Ga0307406_112610221 150
132 3300031995 Ga0307409_101011163 Ga0307409_1010111632 150
133 3300032002 Ga0307416_100309625 Ga0307416_1003096252 150
134 3300032004 Ga0307414_10558651 Ga0307414_105586511 150
135 3300041512 Ga0451853_2361289 Ga0451853_2361289_27_530 150
136 3300044683 Ga0466965_0140756 Ga0466965_0140756_513_971 150
137 3300044901 Ga0466960_0595029 Ga0466960_0595029_117_581 150
138 3300048907 Ga0496104_0241629 Ga0496104_0241629_1135_1611 150
139 3300048908 Ga0496105_0123504 Ga0496105_0123504_901_1377 150
140 3300048916 Ga0496113_0138722 Ga0496113_0138722_553_1029 150
141 3300048918 Ga0496115_0109527 Ga0496115_0109527_542_1018 150
142 3300048920 Ga0496117_0023259 Ga0496117_0023259_637_1092 150
143 3300048921 Ga0496118_0019713 Ga0496118_0019713_157_612 150
144 3300048922 Ga0496119_0015395 Ga0496119_0015395_3317_3775 150
145 3300048923 Ga0496120_0001547 Ga0496120_0001547_17596_18051 150
146 3300048925 Ga0496122_0056788 Ga0496122_0056788_1095_1550 150
147 3300048925 Ga0496122_0287957 Ga0496122_0287957_375_833 150
148 3300048926 Ga0496123_0141809 Ga0496123_0141809_746_1201 150
149 3300048927 Ga0496124_0757652 Ga0496124_0757652_67_522 150
150 3300048928 Ga0496125_0091205 Ga0496125_0091205_189_644 150
151 3300048929 Ga0496126_0093458 Ga0496126_0093458_2148_2603 150
152 3300049586 Ga0501070_0002782 Ga0501070_0002782_13374_13832 150
153 3300001979 JGI24740J21852_10017451 JGI24740J21852_100174514 151
154 3300044765 Ga0466970_0000835 Ga0466970_0000835_3639_4094 151
155 3300044842 Ga0466957_0024556 Ga0466957_0024556_640_1095 151
156 3300045976 Ga0466967_0084466 Ga0466967_0084466_1726_2181 151

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fsx-assembly2.cif.gz_B crystal structure of trypanosoma brucei macrodomain in complex with adp 0.5071 90 114
3ejg-assembly1.cif.gz_A crystal structure of hcov-229e x-domain 0.4418 84 111
3dti-assembly1.cif.gz_A crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae 0.4127 43 143
7xyo-assembly1.cif.gz_A crystal structure of a m61 aminopeptidase family member from myxococcus fulvus 0.307 42 149
3dti-assembly1.cif.gz_A crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae 0.3012 43 143
ID Description Score Start End Superfamily
5fsxB00 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.5071 90 114 3.40.220.10
af_A0A1D6MR53_300_613_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.5047 89 113 3.90.550.10
3dtiA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.4422 43 148 1.10.10.2910
3ejgA00 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.4418 84 111 3.40.220.10
af_A0A1Q0XTP9_219_321_3.30.2010.30 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.4041 71 114 3.30.2010.30
ID Description Score Start End GO Terms
AF-A0A7D8AA05-F1-model_v4 Fe-S oxidoreductase 0.9499 12 150
AF-A0A0B2AB96-F1-model_v4 Fe-S oxidoreductase 0.947 27 148
AF-A0A653MW37-F1-model_v4 Fe-S oxidoreductase 0.9465 1 151
AF-A0A259SH14-F1-model_v4 Fe-S oxidoreductase 0.9448 20 151
AF-A0A368L2M0-F1-model_v4 Fe-S oxidoreductase 0.9448 16 149

Feature Viewer

pLDDT pTM Quality
87.63 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map