F223852

General Info

Members Datasets Scaffolds Average Seq Length
156 115 312 73

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10036625|Ga0065707_100366253
Length 76
Sequence MGRLRVLSGRETCQILQQHGFREVRRRGSHIVMQRAEPTTGTVTVPVPDHPELAIGTLLAIIRQSRVPRAAFETSQ

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
56 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
57 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
58 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
59 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
60 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
61 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
62 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
63 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
66 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
67 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
70 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
74 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
77 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
78 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
81 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
102 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
106 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.64
Rhizosphere 98.72
Stem 0
Stem Tuber 0
Unclassified 28.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10036625 3300005295 Unclassified 1109
2 Ga0065707_10643338 3300005295 Bacteria 667
3 Ga0070658_10011218 3300005327 Bacteria 7182
4 Ga0070690_100064302 3300005330 Bacteria 2369
5 Ga0070670_100876836 3300005331 Bacteria 813
6 Ga0068869_100076480 3300005334 Bacteria 2488
7 Ga0070666_10180163 3300005335 Bacteria 1482
8 Ga0070666_11069215 3300005335 Bacteria 599
9 Ga0070680_101311476 3300005336 Unclassified 626
10 Ga0070682_100000002 3300005337 Bacteria 506802
11 Ga0070691_10315518 3300005341 Bacteria 858
12 Ga0070659_101244038 3300005366 Bacteria 659
13 Ga0070667_100454643 3300005367 Bacteria 1170
14 Ga0070714_102225736 3300005435 Unclassified 534
15 Ga0070713_100008157 3300005436 Bacteria 7416
16 Ga0070694_100191111 3300005444 Unclassified 1520
17 Ga0070708_101487871 3300005445 Bacteria 631
18 Ga0070663_101761115 3300005455 Bacteria 555
19 Ga0068867_100931033 3300005459 Bacteria 784
20 Ga0070707_100115812 3300005468 Bacteria 2601
21 Ga0070707_100325867 3300005468 Bacteria 1492
22 Ga0070707_101064072 3300005468 Unclassified 775
23 Ga0070698_100364835 3300005471 Bacteria 1376
24 Ga0070698_101614719 3300005471 Unclassified 600
25 Ga0070699_100021952 3300005518 Bacteria 5500
26 Ga0070679_100620030 3300005530 Bacteria 1025
27 Ga0070697_100643531 3300005536 Bacteria 933
28 Ga0070697_101366361 3300005536 Unclassified 632
29 Ga0070665_100091599 3300005548 Bacteria 3045
30 Ga0070664_101156827 3300005564 Unclassified 729
31 Ga0070702_100239212 3300005615 Unclassified 1224
32 Ga0068858_101276895 3300005842 Unclassified 722
33 Ga0081455_10001495 3300005937 Bacteria 28902
34 Ga0081539_10058090 3300005985 Bacteria 2137
35 Ga0070717_11347486 3300006028 Bacteria 648
36 Ga0068871_101520964 3300006358 Unclassified 633
37 Ga0075428_100015121 3300006844 Bacteria 8568
38 Ga0075428_100741323 3300006844 Unclassified 1045
39 Ga0075428_101175865 3300006844 Unclassified 809
40 Ga0075428_101347576 3300006844 Unclassified 750
41 Ga0075428_101360064 3300006844 Unclassified 746
42 Ga0075430_100006600 3300006846 Bacteria 9779
43 Ga0075430_100019696 3300006846 Bacteria 5740
44 Ga0075430_100235847 3300006846 Bacteria 1516
45 Ga0075431_100032285 3300006847 Bacteria 5395
46 Ga0075429_100000333 3300006880 Bacteria 34186
47 Ga0075429_100037983 3300006880 Bacteria 4191
48 Ga0075429_100190022 3300006880 Bacteria 1799
49 Ga0075429_100371415 3300006880 Bacteria 1252
50 Ga0075429_100671546 3300006880 Unclassified 908
51 Ga0114129_10007590 3300009147 Bacteria 15440
52 Ga0114129_11830869 3300009147 Unclassified 737
53 Ga0114129_12642157 3300009147 Unclassified 599
54 Ga0105249_11348695 3300009553 Bacteria 785
55 Ga0157378_10772088 3300013297 Bacteria 985
56 Ga0182008_10555775 3300014497 Bacteria 638
57 Ga0157379_12518817 3300014968 Bacteria 514
58 Ga0207680_10284129 3300025903 Bacteria 1150
59 Ga0207645_10435250 3300025907 Bacteria 884
60 Ga0207645_10767073 3300025907 Bacteria 656
61 Ga0207705_10038470 3300025909 Bacteria 3426
62 Ga0207652_10973121 3300025921 Bacteria 747
63 Ga0207646_10474047 3300025922 Bacteria 1129
64 Ga0207650_10627833 3300025925 Bacteria 905
65 Ga0207686_10170571 3300025934 Bacteria 1534
66 Ga0207689_10006274 3300025942 Bacteria 10537
67 Ga0207703_10292036 3300026035 Bacteria 1484
68 Ga0207639_10687111 3300026041 Bacteria 949
69 Ga0268266_11008050 3300028379 Bacteria 806
70 Ga0265316_10044460 3300031344 Unclassified 3533
71 Ga0316579_10359937 3300031691 Bacteria 704
72 Ga0316576_10492124 3300031727 Unclassified 903
73 Ga0316578_10470836 3300031728 Unclassified 741
74 Ga0316583_10039658 3300032133 Bacteria 1667
75 Ga0373949_0042797 3300035090 Bacteria 1119
76 Ga0373932_0048252 3300035112 Archaea 1254
77 Ga0373939_0314829 3300035114 Unclassified 628
78 Ga0373954_0232232 3300035118 Bacteria 908
79 Ga0373960_0095166 3300035121 Bacteria 958
80 Ga0373955_0308473 3300035172 Bacteria 955
81 Ga0373942_0090088 3300035207 Bacteria 923
82 Ga0373933_0141138 3300035724 Bacteria 1521
83 Ga0373933_0401414 3300035724 Bacteria 894
84 Ga0373937_0424504 3300036401 Bacteria 1262
85 Ga0373937_0429293 3300036401 Bacteria 1254
86 Ga0316582_1051589 3300036647 Unclassified 555
87 Ga0316582_1169364 3300036647 Unclassified 524
88 Ga0316584_0936672 3300036712 Unclassified 581
89 Ga0316581_0048513 3300037588 Bacteria 1300
90 Ga0436365_0406526 3300039437 Bacteria 22508
91 Ga0436362_0385017 3300039453 Bacteria 5526
92 Ga0439459_0148307 3300042438 Bacteria 611
93 Ga0451577_0993743 3300042876 Bacteria 754
94 Ga0451576_0660725 3300045051 Archaea 1098
95 Ga0495580_0871301 3300046472 Unclassified 580
96 Ga0495594_0034649 3300046499 Bacteria 2747
97 Ga0495630_0792770 3300046517 Bacteria 723
98 Ga0495598_0460021 3300046537 Bacteria 505
99 Ga0495657_0340509 3300046675 Bacteria 889
100 Ga0495581_0068797 3300047315 Bacteria 2047
101 Ga0495680_0114722 3300047322 Bacteria 1994
102 Ga0496106_1027390 3300048909 Unclassified 648
103 Ga0501031_0000127 3300049568 Bacteria 42244
104 Ga0501032_0113842 3300049569 Bacteria 1789
105 Ga0501033_0001215 3300049570 Bacteria 23125
106 Ga0501033_0051032 3300049570 Bacteria 3067
107 Ga0501033_0337059 3300049570 Bacteria 1058
108 Ga0501033_1157473 3300049570 Unclassified 513
109 Ga0501034_0146176 3300049571 Bacteria 2341
110 Ga0501034_0473175 3300049571 Bacteria 1169
111 Ga0501034_0730975 3300049571 Unclassified 886
112 Ga0501036_0613823 3300049572 Bacteria 902
113 Ga0501037_0162958 3300049573 Bacteria 1589
114 Ga0501037_0210226 3300049573 Unclassified 1372
115 Ga0501038_1107252 3300049574 Bacteria 578
116 Ga0501039_0230556 3300049575 Bacteria 1456
117 Ga0501040_0936881 3300049576 Unclassified 628
118 Ga0501041_0993772 3300049577 Unclassified 540
119 Ga0501043_0138300 3300049579 Unclassified 1908
120 Ga0501043_0222384 3300049579 Bacteria 1460
121 Ga0501043_0779789 3300049579 Bacteria 693
122 Ga0501046_0859763 3300049580 Bacteria 634
123 Ga0501047_0113777 3300049581 Bacteria 2588
124 Ga0501047_0555248 3300049581 Bacteria 972
125 Ga0501047_1345604 3300049581 Unclassified 529
126 Ga0501067_0578009 3300049583 Bacteria 630
127 Ga0501070_0626481 3300049586 Bacteria 856
128 Ga0501070_1438460 3300049586 Bacteria 523
129 Ga0501072_1469702 3300049588 Unclassified 526
130 Ga0501073_0580374 3300049589 Bacteria 774
131 Ga0501074_0933148 3300049590 Bacteria 611
132 Ga0501075_0525806 3300049591 Bacteria 903
133 Ga0501076_0766018 3300049592 Unclassified 796
134 Ga0501076_1246780 3300049592 Bacteria 612
135 Ga0501077_0644501 3300049593 Bacteria 681
136 Ga0501206_046324 3300049653 Unclassified 682
137 Ga0501079_0391942 3300049741 Bacteria 1089
138 Ga0501080_0310402 3300049742 Bacteria 1429
139 Ga0501080_1186775 3300049742 Unclassified 657
140 Ga0501081_0890026 3300049743 Unclassified 671
141 Ga0501283_067088 3300049779 Unclassified 656
142 Ga0501035_1263514 3300049822 Unclassified 571
143 Ga0501044_0000224 3300049823 Bacteria 71726
144 Ga0501044_0104211 3300049823 Bacteria 2851
145 Ga0501045_0350940 3300049824 Bacteria 1098
146 nmdc:mga05p37_1575009_c1 3300050507 Unclassified 649
147 nmdc:mga05p37_3659_c1 3300050507 Bacteria 15469
148 nmdc:mga09592_433850_c1 3300050508 Bacteria 1134
149 nmdc:mga0qj67_167_c1 3300050509 Bacteria 44082
150 nmdc:mga0qj67_366712_c1 3300050509 Bacteria 1163
151 nmdc:mga0qj67_367619_c1 3300050509 Unclassified 1162
152 nmdc:mga06r32_45175_c1 3300050510 Bacteria 4198
153 Ga0587091_152430 3300059511 Unclassified 588
154 Ga0501082_0101885 3300060353 Bacteria 2484
155 Ga0501082_0436752 3300060353 Bacteria 1143
156 Ga0501082_0559968 3300060353 Unclassified 1000
157 Ga0065707_10036625
158 Ga0065707_10643338
159 Ga0070658_10011218
160 Ga0070690_100064302
161 Ga0070670_100876836
162 Ga0068869_100076480
163 Ga0070666_10180163
164 Ga0070666_11069215
165 Ga0070680_101311476
166 Ga0070682_100000002
167 Ga0070691_10315518
168 Ga0070659_101244038
169 Ga0070667_100454643
170 Ga0070714_102225736
171 Ga0070713_100008157
172 Ga0070694_100191111
173 Ga0070708_101487871
174 Ga0070663_101761115
175 Ga0068867_100931033
176 Ga0070707_100115812
177 Ga0070707_100325867
178 Ga0070707_101064072
179 Ga0070698_100364835
180 Ga0070698_101614719
181 Ga0070699_100021952
182 Ga0070679_100620030
183 Ga0070697_100643531
184 Ga0070697_101366361
185 Ga0070665_100091599
186 Ga0070664_101156827
187 Ga0070702_100239212
188 Ga0068858_101276895
189 Ga0081455_10001495
190 Ga0081539_10058090
191 Ga0070717_11347486
192 Ga0068871_101520964
193 Ga0075428_100015121
194 Ga0075428_100741323
195 Ga0075428_101175865
196 Ga0075428_101347576
197 Ga0075428_101360064
198 Ga0075430_100006600
199 Ga0075430_100019696
200 Ga0075430_100235847
201 Ga0075431_100032285
202 Ga0075429_100000333
203 Ga0075429_100037983
204 Ga0075429_100190022
205 Ga0075429_100371415
206 Ga0075429_100671546
207 Ga0114129_10007590
208 Ga0114129_11830869
209 Ga0114129_12642157
210 Ga0105249_11348695
211 Ga0157378_10772088
212 Ga0182008_10555775
213 Ga0157379_12518817
214 Ga0207680_10284129
215 Ga0207645_10435250
216 Ga0207645_10767073
217 Ga0207705_10038470
218 Ga0207652_10973121
219 Ga0207646_10474047
220 Ga0207650_10627833
221 Ga0207686_10170571
222 Ga0207689_10006274
223 Ga0207703_10292036
224 Ga0207639_10687111
225 Ga0268266_11008050
226 Ga0265316_10044460
227 Ga0316579_10359937
228 Ga0316576_10492124
229 Ga0316578_10470836
230 Ga0316583_10039658
231 Ga0373949_0042797
232 Ga0373932_0048252
233 Ga0373939_0314829
234 Ga0373954_0232232
235 Ga0373960_0095166
236 Ga0373955_0308473
237 Ga0373942_0090088
238 Ga0373933_0141138
239 Ga0373933_0401414
240 Ga0373937_0424504
241 Ga0373937_0429293
242 Ga0316582_1051589
243 Ga0316582_1169364
244 Ga0316584_0936672
245 Ga0316581_0048513
246 Ga0436365_0406526
247 Ga0436362_0385017
248 Ga0439459_0148307
249 Ga0451577_0993743
250 Ga0451576_0660725
251 Ga0495580_0871301
252 Ga0495594_0034649
253 Ga0495630_0792770
254 Ga0495598_0460021
255 Ga0495657_0340509
256 Ga0495581_0068797
257 Ga0495680_0114722
258 Ga0496106_1027390
259 Ga0501031_0000127
260 Ga0501032_0113842
261 Ga0501033_0001215
262 Ga0501033_0051032
263 Ga0501033_0337059
264 Ga0501033_1157473
265 Ga0501034_0146176
266 Ga0501034_0473175
267 Ga0501034_0730975
268 Ga0501036_0613823
269 Ga0501037_0162958
270 Ga0501037_0210226
271 Ga0501038_1107252
272 Ga0501039_0230556
273 Ga0501040_0936881
274 Ga0501041_0993772
275 Ga0501043_0138300
276 Ga0501043_0222384
277 Ga0501043_0779789
278 Ga0501046_0859763
279 Ga0501047_0113777
280 Ga0501047_0555248
281 Ga0501047_1345604
282 Ga0501067_0578009
283 Ga0501070_0626481
284 Ga0501070_1438460
285 Ga0501072_1469702
286 Ga0501073_0580374
287 Ga0501074_0933148
288 Ga0501075_0525806
289 Ga0501076_0766018
290 Ga0501076_1246780
291 Ga0501077_0644501
292 Ga0501206_046324
293 Ga0501079_0391942
294 Ga0501080_0310402
295 Ga0501080_1186775
296 Ga0501081_0890026
297 Ga0501283_067088
298 Ga0501035_1263514
299 Ga0501044_0000224
300 Ga0501044_0104211
301 Ga0501045_0350940
302 nmdc:mga05p37_1575009_c1
303 nmdc:mga05p37_3659_c1
304 nmdc:mga09592_433850_c1
305 nmdc:mga0qj67_167_c1
306 nmdc:mga0qj67_366712_c1
307 nmdc:mga0qj67_367619_c1
308 nmdc:mga06r32_45175_c1
309 Ga0587091_152430
310 Ga0501082_0101885
311 Ga0501082_0436752
312 Ga0501082_0559968

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

9

67

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1whz-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.8736 5 72
1whz-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.8052 5 72
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.7745 7 67
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.7527 7 67
1reo-assembly1.cif.gz_A l-amino acid oxidase from agkistrodon halys pallas 0.7089 20 48
ID Description Score Start End Superfamily
af_Q54V25_1_59_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8059 7 67 3.30.920.30
af_Q54V25_1_59_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.7936 7 67 3.30.920.30
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.7745 7 67 3.30.920.30
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.7526 7 67 3.30.920.30
3oajB02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7471 9 53 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2N6KBT4-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9714 1 75 GO:0003729
GO:0004519
AF-X1IFB4-F1-model_v4 Addiction module toxin, HicA family 0.9686 1 67 GO:0003729
GO:0004519
AF-W6M3B1-F1-model_v4 YcfA-like protein 0.9643 1 74 GO:0003729
GO:0004519
AF-A0A7V9AC65-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.963 1 72 GO:0003729
GO:0004519
AF-A0A0F7DBS8-F1-model_v4 Putative periplasmic or secreted lipoprotein 0.9595 3 72 GO:0003729
GO:0004519

Map