F223361

General Info

Members Datasets Scaffolds Average Seq Length
155 98 310 109

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_570380_c1|nmdc:mga00v17_570380_c1_318_644
Length 102
Sequence MPTLPPDFADLEPFADWALPSEADRYAKRLASSMDELQAFYDAAFPDHLKAIDLDGISDEDQNLLWLFSSLVTVSFPVEVWRQPRVPDSGASSVDVTLEPVP

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
5 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
11 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
26 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
27 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
28 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
29 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
30 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
31 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
32 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
33 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
34 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
35 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
36 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
37 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
38 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
39 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
40 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
41 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
42 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
43 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
44 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
45 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
46 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
47 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
48 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
49 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
50 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
51 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
52 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
53 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
54 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
55 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
56 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
57 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
67 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
68 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
69 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
70 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
71 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
72 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
73 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
74 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
75 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
76 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
79 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
80 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
81 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
82 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
83 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
84 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
85 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
86 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
87 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
88 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
89 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
90 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
91 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
92 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
93 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
94 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
95 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
96 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
97 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
98 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0
Isolates 1.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.32
Nodule 0
Rhizoplane 2.58
Rhizosphere 79.35
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_570380_c1 3300050491 Bacteria 731
2 JGI24739J22299_10040558 3300001989 Bacteria 1553
3 JGI24735J21928_10031865 3300002067 Bacteria 1562
4 Ga0068855_101542293 3300005563 Bacteria 681
5 Ga0081455_10032197 3300005937 Bacteria 4729
6 Ga0081538_10277965 3300005981 Bacteria 623
7 Ga0075365_10029836 3300006038 Bacteria 3488
8 Ga0075368_10398717 3300006042 Bacteria 604
9 Ga0075363_100074016 3300006048 Bacteria 1854
10 Ga0075364_10732259 3300006051 Bacteria 675
11 Ga0075362_10399422 3300006177 Bacteria 693
12 Ga0075367_10152460 3300006178 Bacteria 1435
13 Ga0075428_100025204 3300006844 Bacteria 6581
14 Ga0075428_100088090 3300006844 Bacteria 3386
15 Ga0075430_100003076 3300006846 Bacteria 13935
16 Ga0075430_100098864 3300006846 Bacteria 2437
17 Ga0075431_100006998 3300006847 Bacteria 11216
18 Ga0075431_100440600 3300006847 Bacteria 1300
19 Ga0075431_100896467 3300006847 Bacteria 857
20 Ga0075429_100008333 3300006880 Bacteria 9018
21 Ga0105240_10418586 3300009093 Bacteria 1506
22 Ga0111539_10004723 3300009094 Bacteria 17802
23 Ga0111539_10977668 3300009094 Bacteria 984
24 Ga0111539_13002448 3300009094 Unclassified 545
25 Ga0114129_10003736 3300009147 Bacteria 21460
26 Ga0114129_10032513 3300009147 Bacteria 7372
27 Ga0114129_10059524 3300009147 Bacteria 5340
28 Ga0105239_10282086 3300010375 Bacteria 1870
29 Ga0105239_12590488 3300010375 Bacteria 591
30 Ga0157376_13093712 3300014969 Bacteria 504
31 Ga0213876_10000443 3300021384 Bacteria 33726
32 Ga0213876_10001530 3300021384 Bacteria 14305
33 Ga0207695_10414475 3300025913 Bacteria 1231
34 Ga0207667_11517643 3300025949 Unclassified 641
35 Ga0207428_10041272 3300027907 Bacteria 3736
36 Ga0207428_11181541 3300027907 Bacteria 533
37 Ga0307512_10022800 3300030522 Bacteria 5613
38 Ga0307508_10126049 3300031616 Bacteria 2163
39 Ga0307410_11056703 3300031852 Bacteria 702
40 Ga0307407_10025319 3300031903 Bacteria 3126
41 Ga0307409_100011493 3300031995 Bacteria 5588
42 Ga0307416_100466711 3300032002 Bacteria 1319
43 Ga0307411_10050489 3300032005 Bacteria 2709
44 Ga0307415_100040761 3300032126 Bacteria 3079
45 Ga0436365_0780834 3300039437 Bacteria 14438
46 Ga0436365_1704332 3300039437 Bacteria 30863
47 Ga0436362_0725806 3300039453 Bacteria 546
48 Ga0451797_1115229 3300041453 Bacteria 1021
49 Ga0451800_0493935 3300041459 Bacteria 523
50 Ga0451800_1042277 3300041459 Bacteria 510
51 Ga0451802_0619675 3300041460 Bacteria 672
52 Ga0451833_1432015 3300041491 Bacteria 568
53 Ga0451837_1462121 3300041494 Bacteria 1163
54 Ga0451843_0706596 3300041509 Bacteria 4400
55 Ga0451853_3943238 3300041512 Bacteria 6930
56 Ga0450903_000589 3300042138 Bacteria 7431
57 Ga0466963_0046707 3300044694 Bacteria 2856
58 Ga0466963_0256695 3300044694 Bacteria 1227
59 Ga0466958_0027542 3300045836 Bacteria 3364
60 Ga0466958_0479662 3300045836 Bacteria 806
61 Ga0466967_0082001 3300045976 Bacteria 2914
62 Ga0466967_0234217 3300045976 Bacteria 1749
63 Ga0466967_0295214 3300045976 Bacteria 1558
64 Ga0466967_1918435 3300045976 Bacteria 589
65 Ga0466967_2472450 3300045976 Unclassified 514
66 Ga0495592_0494403 3300046454 Bacteria 760
67 Ga0495629_0511761 3300046459 Bacteria 809
68 Ga0495653_0050603 3300046463 Bacteria 3195
69 Ga0495640_0509431 3300046533 Bacteria 732
70 Ga0495587_0054611 3300046536 Bacteria 2354
71 Ga0495613_0395924 3300046689 Bacteria 943
72 Ga0495672_0003115 3300047320 Bacteria 14471
73 Ga0495684_0367857 3300047471 Bacteria 1017
74 Ga0495593_0441431 3300047673 Bacteria 651
75 Ga0501032_0011565 3300049569 Bacteria 6333
76 Ga0501033_0007631 3300049570 Bacteria 8408
77 Ga0501034_0197841 3300049571 Bacteria 1969
78 Ga0501034_0320540 3300049571 Bacteria 1483
79 Ga0501034_0466680 3300049571 Bacteria 1179
80 Ga0501034_0984638 3300049571 Bacteria 728
81 Ga0501036_0144402 3300049572 Bacteria 2007
82 Ga0501037_0011211 3300049573 Bacteria 6598
83 Ga0501037_0254102 3300049573 Bacteria 1229
84 Ga0501037_0452718 3300049573 Bacteria 875
85 Ga0501038_0017035 3300049574 Bacteria 6575
86 Ga0501040_0045267 3300049576 Bacteria 3001
87 Ga0501041_0643858 3300049577 Bacteria 677
88 Ga0501043_0110440 3300049579 Bacteria 2159
89 Ga0501043_0559867 3300049579 Bacteria 848
90 Ga0501043_0910539 3300049579 Bacteria 630
91 Ga0501047_0119458 3300049581 Bacteria 2518
92 Ga0501047_0524383 3300049581 Bacteria 1010
93 Ga0501047_0797930 3300049581 Bacteria 759
94 Ga0501069_0000043 3300049585 Bacteria 77795
95 Ga0501069_0069124 3300049585 Bacteria 1977
96 Ga0501069_0491831 3300049585 Bacteria 731
97 Ga0501070_0000298 3300049586 Bacteria 46144
98 Ga0501070_0005660 3300049586 Bacteria 10652
99 Ga0501070_0007824 3300049586 Bacteria 9059
100 Ga0501070_0011193 3300049586 Bacteria 7573
101 Ga0501070_0341986 3300049586 Bacteria 1215
102 Ga0501070_0764809 3300049586 Bacteria 760
103 Ga0501071_0162280 3300049587 Bacteria 1671
104 Ga0501071_0609756 3300049587 Bacteria 839
105 Ga0501072_0096394 3300049588 Bacteria 2351
106 Ga0501073_0027534 3300049589 Bacteria 4065
107 Ga0501074_0009727 3300049590 Bacteria 6982
108 Ga0501074_0053307 3300049590 Bacteria 2918
109 Ga0501074_0657318 3300049590 Bacteria 740
110 Ga0501076_1555926 3300049592 Bacteria 543
111 Ga0501079_0004181 3300049741 Bacteria 10699
112 Ga0501080_0000863 3300049742 Bacteria 24831
113 Ga0501080_0035867 3300049742 Bacteria 4629
114 Ga0501080_0054153 3300049742 Bacteria 3736
115 Ga0501080_0098101 3300049742 Bacteria 2719
116 Ga0501080_0155391 3300049742 Bacteria 2113
117 Ga0501080_1011626 3300049742 Bacteria 720
118 Ga0501083_1106233 3300049744 Bacteria 516
119 Ga0501035_0121149 3300049822 Bacteria 2287
120 Ga0501035_0218818 3300049822 Bacteria 1627
121 Ga0501035_0699336 3300049822 Bacteria 818
122 Ga0501044_0001664 3300049823 Bacteria 26087
123 Ga0501044_0020625 3300049823 Bacteria 7037
124 Ga0501044_0220615 3300049823 Bacteria 1847
125 Ga0501045_0738392 3300049824 Bacteria 726
126 nmdc:mga03n38_619147_c1 3300050490 Bacteria 618
127 nmdc:mga00v17_49116_c1 3300050491 Bacteria 2559
128 nmdc:mga06z11_238988_c1 3300050494 Bacteria 1066
129 nmdc:mga06z11_402450_c1 3300050494 Bacteria 824
130 nmdc:mga05p37_34438_c1 3300050507 Bacteria 6204
131 nmdc:mga05p37_913_c1 3300050507 Bacteria 33348
132 nmdc:mga09592_594_c1 3300050508 Bacteria 27417
133 nmdc:mga0qj67_283_c1 3300050509 Bacteria 35322
134 nmdc:mga0qj67_539043_c1 3300050509 Bacteria 936
135 nmdc:mga0qj67_870484_c1 3300050509 Bacteria 711
136 nmdc:mga06r32_181476_c1 3300050510 Bacteria 2091
137 nmdc:mga06r32_258705_c1 3300050510 Bacteria 1728
138 nmdc:mga06r32_285998_c1 3300050510 Bacteria 1636
139 nmdc:mga06r32_855_c1 3300050510 Bacteria 27030
140 nmdc:mga08y16_274464_c1 3300050511 Bacteria 1740
141 nmdc:mga08y16_50249_c2 3300050511 Bacteria 3997
142 nmdc:mga08y16_5095_c1 3300050511 Bacteria 13734
143 nmdc:mga0rr50_1045167_c1 3300050513 Bacteria 695
144 nmdc:mga0a205_1279427_c1 3300050515 Bacteria 581
145 Ga0495595_0118277 3300053084 Bacteria 1290
146 Ga0500566_0000606 3300053094 Bacteria 20147
147 Ga0500641_0328848 3300053096 Bacteria 620
148 Ga0500556_0376872 3300053104 Bacteria 547
149 Ga0500577_0222885 3300053142 Bacteria 816
150 Ga0500604_0063160 3300053151 Bacteria 1167
151 Ga0501084_1378768 3300054114 Bacteria 591
152 Ga0501082_0178298 3300060353 Bacteria 1848
153 2785374583 2784746768 Bacteria 10036182
154 2812361054 2811994879 Bacteria 9313447
155 2946073320 2946072368 Bacteria 8999607
156 nmdc:mga00v17_570380_c1
157 JGI24739J22299_10040558
158 JGI24735J21928_10031865
159 Ga0068855_101542293
160 Ga0081455_10032197
161 Ga0081538_10277965
162 Ga0075365_10029836
163 Ga0075368_10398717
164 Ga0075363_100074016
165 Ga0075364_10732259
166 Ga0075362_10399422
167 Ga0075367_10152460
168 Ga0075428_100025204
169 Ga0075428_100088090
170 Ga0075430_100003076
171 Ga0075430_100098864
172 Ga0075431_100006998
173 Ga0075431_100440600
174 Ga0075431_100896467
175 Ga0075429_100008333
176 Ga0105240_10418586
177 Ga0111539_10004723
178 Ga0111539_10977668
179 Ga0111539_13002448
180 Ga0114129_10003736
181 Ga0114129_10032513
182 Ga0114129_10059524
183 Ga0105239_10282086
184 Ga0105239_12590488
185 Ga0157376_13093712
186 Ga0213876_10000443
187 Ga0213876_10001530
188 Ga0207695_10414475
189 Ga0207667_11517643
190 Ga0207428_10041272
191 Ga0207428_11181541
192 Ga0307512_10022800
193 Ga0307508_10126049
194 Ga0307410_11056703
195 Ga0307407_10025319
196 Ga0307409_100011493
197 Ga0307416_100466711
198 Ga0307411_10050489
199 Ga0307415_100040761
200 Ga0436365_0780834
201 Ga0436365_1704332
202 Ga0436362_0725806
203 Ga0451797_1115229
204 Ga0451800_0493935
205 Ga0451800_1042277
206 Ga0451802_0619675
207 Ga0451833_1432015
208 Ga0451837_1462121
209 Ga0451843_0706596
210 Ga0451853_3943238
211 Ga0450903_000589
212 Ga0466963_0046707
213 Ga0466963_0256695
214 Ga0466958_0027542
215 Ga0466958_0479662
216 Ga0466967_0082001
217 Ga0466967_0234217
218 Ga0466967_0295214
219 Ga0466967_1918435
220 Ga0466967_2472450
221 Ga0495592_0494403
222 Ga0495629_0511761
223 Ga0495653_0050603
224 Ga0495640_0509431
225 Ga0495587_0054611
226 Ga0495613_0395924
227 Ga0495672_0003115
228 Ga0495684_0367857
229 Ga0495593_0441431
230 Ga0501032_0011565
231 Ga0501033_0007631
232 Ga0501034_0197841
233 Ga0501034_0320540
234 Ga0501034_0466680
235 Ga0501034_0984638
236 Ga0501036_0144402
237 Ga0501037_0011211
238 Ga0501037_0254102
239 Ga0501037_0452718
240 Ga0501038_0017035
241 Ga0501040_0045267
242 Ga0501041_0643858
243 Ga0501043_0110440
244 Ga0501043_0559867
245 Ga0501043_0910539
246 Ga0501047_0119458
247 Ga0501047_0524383
248 Ga0501047_0797930
249 Ga0501069_0000043
250 Ga0501069_0069124
251 Ga0501069_0491831
252 Ga0501070_0000298
253 Ga0501070_0005660
254 Ga0501070_0007824
255 Ga0501070_0011193
256 Ga0501070_0341986
257 Ga0501070_0764809
258 Ga0501071_0162280
259 Ga0501071_0609756
260 Ga0501072_0096394
261 Ga0501073_0027534
262 Ga0501074_0009727
263 Ga0501074_0053307
264 Ga0501074_0657318
265 Ga0501076_1555926
266 Ga0501079_0004181
267 Ga0501080_0000863
268 Ga0501080_0035867
269 Ga0501080_0054153
270 Ga0501080_0098101
271 Ga0501080_0155391
272 Ga0501080_1011626
273 Ga0501083_1106233
274 Ga0501035_0121149
275 Ga0501035_0218818
276 Ga0501035_0699336
277 Ga0501044_0001664
278 Ga0501044_0020625
279 Ga0501044_0220615
280 Ga0501045_0738392
281 nmdc:mga03n38_619147_c1
282 nmdc:mga00v17_49116_c1
283 nmdc:mga06z11_238988_c1
284 nmdc:mga06z11_402450_c1
285 nmdc:mga05p37_34438_c1
286 nmdc:mga05p37_913_c1
287 nmdc:mga09592_594_c1
288 nmdc:mga0qj67_283_c1
289 nmdc:mga0qj67_539043_c1
290 nmdc:mga0qj67_870484_c1
291 nmdc:mga06r32_181476_c1
292 nmdc:mga06r32_258705_c1
293 nmdc:mga06r32_285998_c1
294 nmdc:mga06r32_855_c1
295 nmdc:mga08y16_274464_c1
296 nmdc:mga08y16_50249_c2
297 nmdc:mga08y16_5095_c1
298 nmdc:mga0rr50_1045167_c1
299 nmdc:mga0a205_1279427_c1
300 Ga0495595_0118277
301 Ga0500566_0000606
302 Ga0500641_0328848
303 Ga0500556_0376872
304 Ga0500577_0222885
305 Ga0500604_0063160
306 Ga0501084_1378768
307 Ga0501082_0178298
308 2785374583
309 2812361054
310 2946073320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a9z-assembly1.cif.gz_AY complex of thermous thermophilus ribosome bound to bipa-gdpcp 0.6148 24 89
5a9z-assembly1.cif.gz_AY complex of thermous thermophilus ribosome bound to bipa-gdpcp 0.5744 24 89
7nkj-assembly1.cif.gz_G mycobacterium smegmatis atp synthase f1 state 3 0.5117 24 87
7sau-assembly1.cif.gz_D structure of gldlm, the proton-powered motor that drives type ix protein secretion and gliding motility in schleiferia thermophila 0.5044 36 94
4v5e-assembly1.cif.gz_B2 insights into translational termination from the structure of rf2 bound to the ribosome 0.4665 24 84
ID Description Score Start End Superfamily
af_Q9VVM8_703_798_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.518 8 87 1.20.1410.10
af_O01510_1_467_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4948 8 92 1.25.10.10
af_P54141_12_244_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.48 20 87 1.20.1070.10
af_K7LRH1_363_518_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4726 8 83 1.25.40.10
af_A0A1D6HGQ8_240_335_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4721 16 101 1.20.58.160
ID Description Score Start End GO Terms
AF-A0A3D5DEC4-F1-model_v4 Uncharacterized protein 0.9344 5 86
AF-A0A3D5DHY9-F1-model_v4 Uncharacterized protein 0.9241 5 91
AF-A0A2N4X260-F1-model_v4 Uncharacterized protein 0.9224 2 86
AF-A0A1B3N219-F1-model_v4 Uncharacterized protein 0.9184 4 87
AF-A0A1A0RGR5-F1-model_v4 Uncharacterized protein 0.9172 1 87

Map