F223307

General Info

Members Datasets Scaffolds Average Seq Length
155 120 310 201

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0353070|Ga0501068_0353070_128_829
Length 233
Sequence MSNESGSTTGVENNLDVKRDIASSVCGGRLIVVSGPSGAGKSSLVRLALSRLDRLHFSVSHTTRAARGAERNAVEYFFVSKEEFLAMRERGEFLEYAEVYGHFYGTSRCEIEKANSQGLDVLLDIDVQGADQVRSKFPEAITTIVLPPSREVLEERLRTRNLNRPEDLERRLRTAAAEVKRFREFDYVIVNDDLERAASQLEAIILAERQRVERQAETAETIISSFGGDLIYG

Samples

Sample ID Description Type Environment
1 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
59 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
63 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
64 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
67 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
71 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
72 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
73 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
74 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
75 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
79 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
90 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
91 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 1.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.65
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 12.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501068_0353070 3300049584 Bacteria 945
2 Ga0070658_10007012 3300005327 Bacteria 9101
3 Ga0070683_100026466 3300005329 Bacteria 5223
4 Ga0070670_100713695 3300005331 Unclassified 902
5 Ga0070671_100982320 3300005355 Bacteria 739
6 Ga0070673_100935191 3300005364 Bacteria 805
7 Ga0070711_100291346 3300005439 Bacteria 1295
8 Ga0070694_100673261 3300005444 Bacteria 839
9 Ga0070681_10077579 3300005458 Bacteria 3279
10 Ga0070706_100074757 3300005467 Bacteria 3136
11 Ga0070699_100034470 3300005518 Unclassified 4375
12 Ga0070679_100600458 3300005530 Bacteria 1044
13 Ga0070672_100257717 3300005543 Bacteria 1470
14 Ga0068855_100002547 3300005563 Bacteria 22453
15 Ga0068855_100099004 3300005563 Bacteria 3358
16 Ga0068856_100096280 3300005614 Bacteria 2948
17 Ga0068852_100313667 3300005616 Bacteria 1521
18 Ga0068859_100237451 3300005617 Bacteria 1912
19 Ga0068858_100334656 3300005842 Bacteria 1448
20 Ga0068860_100403054 3300005843 Bacteria 1353
21 Ga0068862_100092605 3300005844 Bacteria 2634
22 Ga0070717_10191282 3300006028 Bacteria 1788
23 Ga0097621_100817153 3300006237 Unclassified 864
24 Ga0068871_100313214 3300006358 Unclassified 1380
25 Ga0075428_100025259 3300006844 Bacteria 6574
26 Ga0075428_100083280 3300006844 Bacteria 3490
27 Ga0075431_100044802 3300006847 Bacteria 4562
28 Ga0075434_100538961 3300006871 Bacteria 1187
29 Ga0105240_10000781 3300009093 Bacteria 57631
30 Ga0105240_10004139 3300009093 Bacteria 22222
31 Ga0105240_10004528 3300009093 Bacteria 21116
32 Ga0105240_10709444 3300009093 Bacteria 1097
33 Ga0105241_10418839 3300009174 Bacteria 1178
34 Ga0105248_10511100 3300009177 Bacteria 1355
35 Ga0105248_10537297 3300009177 Bacteria 1319
36 Ga0105237_10453429 3300009545 Unclassified 1288
37 Ga0105238_10241514 3300009551 Bacteria 1784
38 Ga0105249_10636802 3300009553 Bacteria 1123
39 Ga0157370_10001200 3300013104 Bacteria 32372
40 Ga0157369_10017504 3300013105 Bacteria 8054
41 Ga0157369_10339797 3300013105 Bacteria 1560
42 Ga0157374_10593278 3300013296 Unclassified 1117
43 Ga0163162_11744127 3300013306 Unclassified 711
44 Ga0157372_10229059 3300013307 Bacteria 2154
45 Ga0157372_10280975 3300013307 Bacteria 1936
46 Ga0157375_10138423 3300013308 Bacteria 2560
47 Ga0163163_10256875 3300014325 Bacteria 1798
48 Ga0163163_10487664 3300014325 Bacteria 1294
49 Ga0207699_10259163 3300025906 Bacteria 1201
50 Ga0207699_10266415 3300025906 Unclassified 1186
51 Ga0207705_10142069 3300025909 Bacteria 1793
52 Ga0207684_10356978 3300025910 Unclassified 1258
53 Ga0207707_10289006 3300025912 Bacteria 1419
54 Ga0207695_10004204 3300025913 Bacteria 19775
55 Ga0207695_10012222 3300025913 Bacteria 10310
56 Ga0207695_10022122 3300025913 Bacteria 7230
57 Ga0207671_10381796 3300025914 Unclassified 1119
58 Ga0207663_10112455 3300025916 Bacteria 1850
59 Ga0207660_10757756 3300025917 Bacteria 792
60 Ga0207694_10220211 3300025924 Bacteria 1548
61 Ga0207700_10478889 3300025928 Bacteria 1100
62 Ga0207691_10191613 3300025940 Bacteria 1783
63 Ga0207711_10425376 3300025941 Bacteria 1235
64 Ga0207667_10013270 3300025949 Bacteria 9440
65 Ga0207698_10179721 3300026142 Bacteria 1873
66 Ga0307515_10410352 3300028794 Bacteria 977
67 Ga0265338_10011301 3300028800 Bacteria 10333
68 Ga0265338_10243404 3300028800 Bacteria 1331
69 Ga0265324_10007028 3300029957 Bacteria 4624
70 Ga0265762_1056162 3300030760 Unclassified 800
71 Ga0265330_10033425 3300031235 Bacteria 2300
72 Ga0265328_10013347 3300031239 Bacteria 3253
73 Ga0265320_10001658 3300031240 Bacteria 15843
74 Ga0265325_10042585 3300031241 Bacteria 2373
75 Ga0265325_10075702 3300031241 Bacteria 1681
76 Ga0265325_10135832 3300031241 Bacteria 1173
77 Ga0265329_10005314 3300031242 Bacteria 5216
78 Ga0265340_10017848 3300031247 Bacteria 3670
79 Ga0265331_10001584 3300031250 Bacteria 16638
80 Ga0265331_10064197 3300031250 Bacteria 1729
81 Ga0265316_10006160 3300031344 Bacteria 11508
82 Ga0265316_10024650 3300031344 Bacteria 5032
83 Ga0265316_10138797 3300031344 Bacteria 1827
84 Ga0265316_10337012 3300031344 Bacteria 1093
85 Ga0316575_10008829 3300031665 Bacteria 3680
86 Ga0316575_10036436 3300031665 Bacteria 1935
87 Ga0316579_10005214 3300031691 Bacteria 5230
88 Ga0316579_10091428 3300031691 Bacteria 1454
89 Ga0265314_10039688 3300031711 Bacteria 3387
90 Ga0265342_10043166 3300031712 Bacteria 2722
91 Ga0265342_10082290 3300031712 Unclassified 1857
92 Ga0316576_10120293 3300031727 Bacteria 1971
93 Ga0316578_10001000 3300031728 Bacteria 10802
94 Ga0316577_10036188 3300031733 Bacteria 2760
95 Ga0316583_10019321 3300032133 Bacteria 2446
96 Ga0316583_10029110 3300032133 Bacteria 1970
97 Ga0316580_10082672 3300032139 Bacteria 982
98 Ga0316593_10071228 3300032168 Bacteria 1203
99 Ga0373923_0172891 3300035111 Bacteria 990
100 Ga0373936_0034367 3300035113 Unclassified 2014
101 Ga0373954_0003410 3300035118 Bacteria 6731
102 Ga0373943_0103283 3300035170 Bacteria 1494
103 Ga0316574_0051684 3300035398 Bacteria 2562
104 Ga0373935_0574812 3300035692 Bacteria 823
105 Ga0373927_0031175 3300035695 Bacteria 3477
106 Ga0373933_0333609 3300035724 Bacteria 984
107 Ga0373947_0006858 3300035725 Bacteria 6605
108 Ga0373937_0040090 3300036401 Bacteria 4269
109 Ga0373937_0128560 3300036401 Bacteria 2365
110 Ga0373937_0359022 3300036401 Unclassified 1381
111 Ga0316582_0000017 3300036647 Bacteria 39539
112 Ga0316582_0018061 3300036647 Bacteria 4096
113 Ga0316584_0000102 3300036712 Bacteria 35217
114 Ga0316584_0002322 3300036712 Bacteria 11982
115 Ga0373925_0007726 3300037068 Bacteria 7830
116 Ga0373925_0114287 3300037068 Bacteria 2089
117 Ga0373925_0235198 3300037068 Unclassified 1466
118 Ga0373925_0606839 3300037068 Bacteria 901
119 Ga0316581_0000001 3300037588 Bacteria 25966
120 Ga0400483_005596 3300039062 Bacteria 2509
121 Ga0400487_20840 3300039110 Bacteria 20597
122 Ga0451577_0310735 3300042876 Bacteria 1429
123 Ga0453684_0699447 3300044712 Bacteria 1102
124 Ga0451576_0558185 3300045051 Bacteria 1203
125 Ga0495629_0561062 3300046459 Bacteria 766
126 Ga0495580_0064648 3300046472 Bacteria 2564
127 Ga0495580_0150023 3300046472 Bacteria 1615
128 Ga0495580_0333860 3300046472 Bacteria 1029
129 Ga0495665_0071128 3300046531 Unclassified 1832
130 Ga0495645_0199920 3300046543 Bacteria 1357
131 Ga0495667_0140287 3300046559 Unclassified 1558
132 Ga0495635_0116574 3300046663 Unclassified 1823
133 Ga0495635_0353241 3300046663 Bacteria 980
134 Ga0495675_0276723 3300047444 Bacteria 1002
135 Ga0496109_0464241 3300048912 Bacteria 1196
136 Ga0501033_0392312 3300049570 Bacteria 969
137 Ga0501036_0455570 3300049572 Bacteria 1066
138 Ga0501037_0007069 3300049573 Bacteria 8202
139 Ga0501038_0011169 3300049574 Bacteria 8201
140 Ga0501038_0131282 3300049574 Bacteria 2057
141 Ga0501040_0499872 3300049576 Bacteria 876
142 Ga0501040_0511023 3300049576 Unclassified 866
143 Ga0501047_0214874 3300049581 Bacteria 1780
144 Ga0501048_0135738 3300049582 Bacteria 1739
145 Ga0501073_0330351 3300049589 Bacteria 1053
146 Ga0501074_0002517 3300049590 Bacteria 12786
147 Ga0501076_0050035 3300049592 Bacteria 3305
148 Ga0501080_0018551 3300049742 Bacteria 6437
149 Ga0501081_0036311 3300049743 Bacteria 3360
150 nmdc:mga06r32_539007_c1 3300050510 Bacteria 1142
151 nmdc:mga0n895_387938_c1 3300050512 Bacteria 1413
152 Ga0495601_0061658 3300053077 Bacteria 2381
153 Ga0501084_0316837 3300054114 Bacteria 1317
154 Ga0501082_0057270 3300060353 Bacteria 3358
155 Ga0530510_0033583 3300061734 Bacteria 3694
156 Ga0501068_0353070
157 Ga0070658_10007012
158 Ga0070683_100026466
159 Ga0070670_100713695
160 Ga0070671_100982320
161 Ga0070673_100935191
162 Ga0070711_100291346
163 Ga0070694_100673261
164 Ga0070681_10077579
165 Ga0070706_100074757
166 Ga0070699_100034470
167 Ga0070679_100600458
168 Ga0070672_100257717
169 Ga0068855_100002547
170 Ga0068855_100099004
171 Ga0068856_100096280
172 Ga0068852_100313667
173 Ga0068859_100237451
174 Ga0068858_100334656
175 Ga0068860_100403054
176 Ga0068862_100092605
177 Ga0070717_10191282
178 Ga0097621_100817153
179 Ga0068871_100313214
180 Ga0075428_100025259
181 Ga0075428_100083280
182 Ga0075431_100044802
183 Ga0075434_100538961
184 Ga0105240_10000781
185 Ga0105240_10004139
186 Ga0105240_10004528
187 Ga0105240_10709444
188 Ga0105241_10418839
189 Ga0105248_10511100
190 Ga0105248_10537297
191 Ga0105237_10453429
192 Ga0105238_10241514
193 Ga0105249_10636802
194 Ga0157370_10001200
195 Ga0157369_10017504
196 Ga0157369_10339797
197 Ga0157374_10593278
198 Ga0163162_11744127
199 Ga0157372_10229059
200 Ga0157372_10280975
201 Ga0157375_10138423
202 Ga0163163_10256875
203 Ga0163163_10487664
204 Ga0207699_10259163
205 Ga0207699_10266415
206 Ga0207705_10142069
207 Ga0207684_10356978
208 Ga0207707_10289006
209 Ga0207695_10004204
210 Ga0207695_10012222
211 Ga0207695_10022122
212 Ga0207671_10381796
213 Ga0207663_10112455
214 Ga0207660_10757756
215 Ga0207694_10220211
216 Ga0207700_10478889
217 Ga0207691_10191613
218 Ga0207711_10425376
219 Ga0207667_10013270
220 Ga0207698_10179721
221 Ga0307515_10410352
222 Ga0265338_10011301
223 Ga0265338_10243404
224 Ga0265324_10007028
225 Ga0265762_1056162
226 Ga0265330_10033425
227 Ga0265328_10013347
228 Ga0265320_10001658
229 Ga0265325_10042585
230 Ga0265325_10075702
231 Ga0265325_10135832
232 Ga0265329_10005314
233 Ga0265340_10017848
234 Ga0265331_10001584
235 Ga0265331_10064197
236 Ga0265316_10006160
237 Ga0265316_10024650
238 Ga0265316_10138797
239 Ga0265316_10337012
240 Ga0316575_10008829
241 Ga0316575_10036436
242 Ga0316579_10005214
243 Ga0316579_10091428
244 Ga0265314_10039688
245 Ga0265342_10043166
246 Ga0265342_10082290
247 Ga0316576_10120293
248 Ga0316578_10001000
249 Ga0316577_10036188
250 Ga0316583_10019321
251 Ga0316583_10029110
252 Ga0316580_10082672
253 Ga0316593_10071228
254 Ga0373923_0172891
255 Ga0373936_0034367
256 Ga0373954_0003410
257 Ga0373943_0103283
258 Ga0316574_0051684
259 Ga0373935_0574812
260 Ga0373927_0031175
261 Ga0373933_0333609
262 Ga0373947_0006858
263 Ga0373937_0040090
264 Ga0373937_0128560
265 Ga0373937_0359022
266 Ga0316582_0000017
267 Ga0316582_0018061
268 Ga0316584_0000102
269 Ga0316584_0002322
270 Ga0373925_0007726
271 Ga0373925_0114287
272 Ga0373925_0235198
273 Ga0373925_0606839
274 Ga0316581_0000001
275 Ga0400483_005596
276 Ga0400487_20840
277 Ga0451577_0310735
278 Ga0453684_0699447
279 Ga0451576_0558185
280 Ga0495629_0561062
281 Ga0495580_0064648
282 Ga0495580_0150023
283 Ga0495580_0333860
284 Ga0495665_0071128
285 Ga0495645_0199920
286 Ga0495667_0140287
287 Ga0495635_0116574
288 Ga0495635_0353241
289 Ga0495675_0276723
290 Ga0496109_0464241
291 Ga0501033_0392312
292 Ga0501036_0455570
293 Ga0501037_0007069
294 Ga0501038_0011169
295 Ga0501038_0131282
296 Ga0501040_0499872
297 Ga0501040_0511023
298 Ga0501047_0214874
299 Ga0501048_0135738
300 Ga0501073_0330351
301 Ga0501074_0002517
302 Ga0501076_0050035
303 Ga0501080_0018551
304 Ga0501081_0036311
305 nmdc:mga06r32_539007_c1
306 nmdc:mga0n895_387938_c1
307 Ga0495601_0061658
308 Ga0501084_0316837
309 Ga0501082_0057270
310 Ga0530510_0033583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00625

Guanylate_kin

Guanylate kinase

27

208

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yki-assembly1.cif.gz_A crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide 0.9474 32 82
3lnc-assembly1.cif.gz_A crystal structure of guanylate kinase from anaplasma phagocytophilum 0.941 2 182
7sqc-assembly1.cif.gz_1C ciliary c1 central pair apparatus isolated from chlamydomonas reinhardtii 0.9235 4 154
1ex7-assembly1.cif.gz_A crystal structure of yeast guanylate kinase in complex with guanosine-5'-monophosphate 0.9193 1 182
7u5f-assembly1.cif.gz_C crystal structure of guanylate kinase from pseudomonas aeruginosa pao1 in complex with gmp 0.9165 1 200
ID Description Score Start End Superfamily
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9892 33 82 3.30.63.10
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9833 33 81 3.30.63.10
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9642 33 81 3.30.63.10
3neyE02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.959 32 93 3.30.63.10
2qorA02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9532 33 91 3.30.63.10
ID Description Score Start End GO Terms
AF-A0A2V9ZDC4-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9887 1 125 GO:0004385
GO:0005524
GO:0005829
AF-A0A2V7XQS5-F1-model_v4 Multifunctional fusion protein [Includes: DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega); Guanylate kinase (EC 2.7.4.8) (GMP kinase)] 0.9884 1 183 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
GO:0004385
GO:0005524
GO:0005829
AF-A0A2V6P7V1-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9825 2 185 GO:0004385
GO:0005524
GO:0005829
AF-A0A2V9NNE6-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9824 1 185 GO:0004385
GO:0005524
GO:0005829
GO:0016020
AF-A0A2G9Y1L6-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9818 2 183 GO:0004385
GO:0005524
GO:0005829

Map