F222624

General Info

Members Datasets Scaffolds Average Seq Length
155 91 310 127

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10175791|Ga0316578_101757912
Length 133
Sequence MTLELGAVPRDLKYTEDHEWLRDEDGLARVGITEFAQDQLGDVVFVELPGVGDGVTAGEAFGVVESVKAASDLLCPITGTVTEINEKLDDDPELVNSDPYGDGWMIVIEPSSPDELDSLMGPVQYVEMIARAE

Samples

Sample ID Description Type Environment
1 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
38 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
39 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
40 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
41 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
42 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
46 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
47 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
48 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
49 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
50 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
51 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
59 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
60 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
61 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
66 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
74 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
75 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
76 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
77 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
78 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
85 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
86 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
87 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
90 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
91 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 0
Rhizosphere 95.48
Stem 0
Stem Tuber 0
Unclassified 15.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316578_10175791 3300031728 Bacteria 1290
2 JGI25406J46586_10019118 3300003203 Bacteria 2799
3 rootH2_10032593 3300003320 Bacteria 7675
4 Ga0070683_100004788 3300005329 Bacteria 11201
5 Ga0070683_100097220 3300005329 Bacteria 2770
6 Ga0070680_101631798 3300005336 Unclassified 559
7 Ga0070682_101274373 3300005337 Unclassified 623
8 Ga0070660_100424485 3300005339 Bacteria 1101
9 Ga0070691_10353929 3300005341 Bacteria 816
10 Ga0070713_100139329 3300005436 Unclassified 2147
11 Ga0070679_102066640 3300005530 Unclassified 519
12 Ga0070684_100174694 3300005535 Bacteria 1952
13 Ga0070684_100197067 3300005535 Bacteria 1834
14 Ga0070684_100624120 3300005535 Bacteria 1003
15 Ga0070697_100517577 3300005536 Bacteria 1044
16 Ga0070672_100024400 3300005543 Bacteria 4469
17 Ga0070695_100191124 3300005545 Bacteria 1457
18 Ga0070696_100017028 3300005546 Bacteria 4902
19 Ga0070665_101274691 3300005548 Unclassified 745
20 Ga0068857_100917239 3300005577 Bacteria 840
21 Ga0068856_100231298 3300005614 Unclassified 1864
22 Ga0068861_102313358 3300005719 Bacteria 539
23 Ga0068851_10925756 3300005834 Bacteria 547
24 Ga0068860_101473611 3300005843 Bacteria 702
25 Ga0081539_10000019 3300005985 Bacteria 369381
26 Ga0081539_10178061 3300005985 Bacteria 1000
27 Ga0070717_11615221 3300006028 Bacteria 587
28 Ga0105246_10641187 3300011119 Bacteria 923
29 Ga0157369_11656639 3300013105 Unclassified 650
30 Ga0157375_11459721 3300013308 Unclassified 807
31 Ga0163163_10072720 3300014325 Bacteria 3428
32 Ga0163163_10617544 3300014325 Unclassified 1147
33 Ga0157376_10960564 3300014969 Bacteria 875
34 Ga0157376_11589738 3300014969 Bacteria 688
35 Ga0207656_10663060 3300025321 Bacteria 534
36 Ga0207700_10005563 3300025928 Bacteria 7557
37 Ga0207691_10016244 3300025940 Bacteria 7066
38 Ga0207661_10004098 3300025944 Bacteria 10188
39 Ga0207661_10109715 3300025944 Bacteria 2331
40 Ga0207661_10220525 3300025944 Unclassified 1676
41 Ga0207661_10363624 3300025944 Unclassified 1307
42 Ga0207702_10132216 3300026078 Unclassified 2247
43 Ga0207676_11951292 3300026095 Bacteria 586
44 Ga0207675_101840624 3300026118 Bacteria 624
45 Ga0268266_12274553 3300028379 Unclassified 514
46 Ga0265337_1004288 3300028556 Bacteria 5948
47 Ga0265337_1058143 3300028556 Bacteria 1075
48 Ga0265337_1103347 3300028556 Bacteria 775
49 Ga0265319_1000189 3300028563 Bacteria 46797
50 Ga0265319_1003190 3300028563 Bacteria 8629
51 Ga0265319_1004423 3300028563 Bacteria 6958
52 Ga0265319_1035983 3300028563 Bacteria 1696
53 Ga0265319_1036777 3300028563 Bacteria 1672
54 Ga0265334_10014292 3300028573 Bacteria 3310
55 Ga0265318_10000428 3300028577 Bacteria 32073
56 Ga0265318_10036881 3300028577 Bacteria 1874
57 Ga0265318_10154713 3300028577 Unclassified 841
58 Ga0265318_10224418 3300028577 Bacteria 686
59 Ga0265323_10000014 3300028653 Bacteria 106540
60 Ga0265323_10000640 3300028653 Bacteria 19075
61 Ga0265323_10001040 3300028653 Bacteria 14405
62 Ga0265323_10011431 3300028653 Bacteria 3582
63 Ga0265323_10014916 3300028653 Bacteria 3065
64 Ga0265323_10042843 3300028653 Bacteria 1636
65 Ga0265323_10046499 3300028653 Bacteria 1555
66 Ga0265323_10069364 3300028653 Bacteria 1208
67 Ga0265323_10135930 3300028653 Unclassified 793
68 Ga0265323_10145709 3300028653 Unclassified 760
69 Ga0265322_10000757 3300028654 Bacteria 11740
70 Ga0265322_10011144 3300028654 Bacteria 2607
71 Ga0265322_10048679 3300028654 Bacteria 1204
72 Ga0265322_10229789 3300028654 Bacteria 532
73 Ga0307515_10170836 3300028794 Bacteria 2168
74 Ga0265338_10041091 3300028800 Bacteria 4331
75 Ga0265338_10674003 3300028800 Bacteria 715
76 Ga0265330_10088508 3300031235 Bacteria 1330
77 Ga0265330_10229773 3300031235 Bacteria 782
78 Ga0265332_10261770 3300031238 Unclassified 715
79 Ga0265320_10000359 3300031240 Bacteria 37134
80 Ga0265320_10005977 3300031240 Bacteria 7736
81 Ga0265320_10007032 3300031240 Bacteria 7015
82 Ga0265320_10025173 3300031240 Bacteria 3133
83 Ga0265329_10038104 3300031242 Unclassified 1547
84 Ga0265340_10344526 3300031247 Bacteria 659
85 Ga0265339_10304712 3300031249 Bacteria 759
86 Ga0265331_10009127 3300031250 Bacteria 5597
87 Ga0265327_10000057 3300031251 Bacteria 242754
88 Ga0265327_10006352 3300031251 Bacteria 9481
89 Ga0265327_10010940 3300031251 Bacteria 6313
90 Ga0265327_10131462 3300031251 Bacteria 1177
91 Ga0265316_10004460 3300031344 Bacteria 13932
92 Ga0265316_10004651 3300031344 Bacteria 13599
93 Ga0265316_10170800 3300031344 Bacteria 1622
94 Ga0265316_10240016 3300031344 Bacteria 1333
95 Ga0265316_10295337 3300031344 Bacteria 1181
96 Ga0265316_10409200 3300031344 Unclassified 976
97 Ga0265316_10514317 3300031344 Bacteria 854
98 Ga0265313_10002528 3300031595 Bacteria 15688
99 Ga0265313_10041835 3300031595 Unclassified 2255
100 Ga0307508_10000022 3300031616 Bacteria 180417
101 Ga0265314_10015311 3300031711 Bacteria 6089
102 Ga0265314_10022546 3300031711 Bacteria 4823
103 Ga0265314_10024550 3300031711 Bacteria 4568
104 Ga0265314_10115763 3300031711 Bacteria 1696
105 Ga0265314_10363999 3300031711 Unclassified 792
106 Ga0265314_10397815 3300031711 Bacteria 746
107 Ga0265342_10006059 3300031712 Bacteria 9072
108 Ga0265342_10432739 3300031712 Bacteria 676
109 Ga0316577_10094461 3300031733 Bacteria 1675
110 Ga0373931_0872440 3300035691 Bacteria 603
111 Ga0373927_0873370 3300035695 Bacteria 594
112 Ga0316584_0463625 3300036712 Bacteria 894
113 Ga0395905_0000015 3300037471 Bacteria 393880
114 Ga0451849_0743495 3300041505 Bacteria 570
115 Ga0451853_3452677 3300041512 Bacteria 986
116 Ga0439431_0018395 3300041997 Unclassified 1653
117 Ga0439445_0034003 3300042004 Bacteria 1334
118 Ga0451577_0653479 3300042876 Bacteria 953
119 Ga0451577_0849640 3300042876 Bacteria 823
120 Ga0453683_0000997 3300044673 Bacteria 26615
121 Ga0453683_0848930 3300044673 Bacteria 602
122 Ga0466966_0034982 3300044684 Bacteria 3247
123 Ga0453684_0000001 3300044712 Bacteria 2623166
124 Ga0453684_0005542 3300044712 Bacteria 24913
125 Ga0453684_0012391 3300044712 Bacteria 14074
126 Ga0453684_0049964 3300044712 Bacteria 5507
127 Ga0453684_0052685 3300044712 Bacteria 5318
128 Ga0453684_0305767 3300044712 Bacteria 1806
129 Ga0453684_1984462 3300044712 Bacteria 586
130 Ga0466959_0044190 3300045049 Bacteria 3283
131 Ga0451576_0121332 3300045051 Bacteria 2721
132 Ga0451576_0446948 3300045051 Bacteria 1357
133 Ga0451576_1447501 3300045051 Bacteria 714
134 Ga0495584_0526040 3300046491 Bacteria 603
135 Ga0495659_0032589 3300046664 Bacteria 1825
136 Ga0495658_0708285 3300046683 Bacteria 645
137 Ga0495677_0171750 3300047445 Bacteria 839
138 Ga0501291_139399 3300049514 Bacteria 540
139 Ga0501031_0959573 3300049568 Bacteria 547
140 Ga0501032_0013831 3300049569 Bacteria 5725
141 Ga0501034_0052869 3300049571 Bacteria 4092
142 Ga0501046_0046984 3300049580 Bacteria 3424
143 Ga0501046_0341910 3300049580 Bacteria 1087
144 Ga0501047_0291811 3300049581 Unclassified 1474
145 Ga0501070_0333744 3300049586 Bacteria 1232
146 Ga0501243_000250 3300049675 Bacteria 6806
147 Ga0501080_0169554 3300049742 Bacteria 2014
148 Ga0501083_0004161 3300049744 Bacteria 10189
149 Ga0501083_0022164 3300049744 Bacteria 4408
150 Ga0501083_0516867 3300049744 Bacteria 777
151 Ga0501035_0487261 3300049822 Bacteria 1016
152 Ga0501044_0000593 3300049823 Bacteria 43923
153 nmdc:mga09592_1355589_c1 3300050508 Unclassified 583
154 Ga0500588_0312767 3300053146 Bacteria 595
155 Ga0500622_0078203 3300053156 Bacteria 1660
156 Ga0316578_10175791
157 JGI25406J46586_10019118
158 rootH2_10032593
159 Ga0070683_100004788
160 Ga0070683_100097220
161 Ga0070680_101631798
162 Ga0070682_101274373
163 Ga0070660_100424485
164 Ga0070691_10353929
165 Ga0070713_100139329
166 Ga0070679_102066640
167 Ga0070684_100174694
168 Ga0070684_100197067
169 Ga0070684_100624120
170 Ga0070697_100517577
171 Ga0070672_100024400
172 Ga0070695_100191124
173 Ga0070696_100017028
174 Ga0070665_101274691
175 Ga0068857_100917239
176 Ga0068856_100231298
177 Ga0068861_102313358
178 Ga0068851_10925756
179 Ga0068860_101473611
180 Ga0081539_10000019
181 Ga0081539_10178061
182 Ga0070717_11615221
183 Ga0105246_10641187
184 Ga0157369_11656639
185 Ga0157375_11459721
186 Ga0163163_10072720
187 Ga0163163_10617544
188 Ga0157376_10960564
189 Ga0157376_11589738
190 Ga0207656_10663060
191 Ga0207700_10005563
192 Ga0207691_10016244
193 Ga0207661_10004098
194 Ga0207661_10109715
195 Ga0207661_10220525
196 Ga0207661_10363624
197 Ga0207702_10132216
198 Ga0207676_11951292
199 Ga0207675_101840624
200 Ga0268266_12274553
201 Ga0265337_1004288
202 Ga0265337_1058143
203 Ga0265337_1103347
204 Ga0265319_1000189
205 Ga0265319_1003190
206 Ga0265319_1004423
207 Ga0265319_1035983
208 Ga0265319_1036777
209 Ga0265334_10014292
210 Ga0265318_10000428
211 Ga0265318_10036881
212 Ga0265318_10154713
213 Ga0265318_10224418
214 Ga0265323_10000014
215 Ga0265323_10000640
216 Ga0265323_10001040
217 Ga0265323_10011431
218 Ga0265323_10014916
219 Ga0265323_10042843
220 Ga0265323_10046499
221 Ga0265323_10069364
222 Ga0265323_10135930
223 Ga0265323_10145709
224 Ga0265322_10000757
225 Ga0265322_10011144
226 Ga0265322_10048679
227 Ga0265322_10229789
228 Ga0307515_10170836
229 Ga0265338_10041091
230 Ga0265338_10674003
231 Ga0265330_10088508
232 Ga0265330_10229773
233 Ga0265332_10261770
234 Ga0265320_10000359
235 Ga0265320_10005977
236 Ga0265320_10007032
237 Ga0265320_10025173
238 Ga0265329_10038104
239 Ga0265340_10344526
240 Ga0265339_10304712
241 Ga0265331_10009127
242 Ga0265327_10000057
243 Ga0265327_10006352
244 Ga0265327_10010940
245 Ga0265327_10131462
246 Ga0265316_10004460
247 Ga0265316_10004651
248 Ga0265316_10170800
249 Ga0265316_10240016
250 Ga0265316_10295337
251 Ga0265316_10409200
252 Ga0265316_10514317
253 Ga0265313_10002528
254 Ga0265313_10041835
255 Ga0307508_10000022
256 Ga0265314_10015311
257 Ga0265314_10022546
258 Ga0265314_10024550
259 Ga0265314_10115763
260 Ga0265314_10363999
261 Ga0265314_10397815
262 Ga0265342_10006059
263 Ga0265342_10432739
264 Ga0316577_10094461
265 Ga0373931_0872440
266 Ga0373927_0873370
267 Ga0316584_0463625
268 Ga0395905_0000015
269 Ga0451849_0743495
270 Ga0451853_3452677
271 Ga0439431_0018395
272 Ga0439445_0034003
273 Ga0451577_0653479
274 Ga0451577_0849640
275 Ga0453683_0000997
276 Ga0453683_0848930
277 Ga0466966_0034982
278 Ga0453684_0000001
279 Ga0453684_0005542
280 Ga0453684_0012391
281 Ga0453684_0049964
282 Ga0453684_0052685
283 Ga0453684_0305767
284 Ga0453684_1984462
285 Ga0466959_0044190
286 Ga0451576_0121332
287 Ga0451576_0446948
288 Ga0451576_1447501
289 Ga0495584_0526040
290 Ga0495659_0032589
291 Ga0495658_0708285
292 Ga0495677_0171750
293 Ga0501291_139399
294 Ga0501031_0959573
295 Ga0501032_0013831
296 Ga0501034_0052869
297 Ga0501046_0046984
298 Ga0501046_0341910
299 Ga0501047_0291811
300 Ga0501070_0333744
301 Ga0501243_000250
302 Ga0501080_0169554
303 Ga0501083_0004161
304 Ga0501083_0022164
305 Ga0501083_0516867
306 Ga0501035_0487261
307 Ga0501044_0000593
308 nmdc:mga09592_1355589_c1
309 Ga0500588_0312767
310 Ga0500622_0078203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

12

132

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9754 3 128
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9742 2 125
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9719 3 129
3a8k-assembly1.cif.gz_E crystal structure of etd97n-ehred complex 0.9712 3 129
3a7a-assembly2.cif.gz_D crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9691 3 128
ID Description Score Start End Superfamily
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9739 4 129 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9679 8 128 2.40.50.100
af_K7TZ76_31_128_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9594 40 128 2.40.50.100
af_A4IC11_1_107_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9522 21 127 2.40.50.100
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9514 4 129 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A0R2UJF7-F1-model_v4 Glycine cleavage system protein H 0.9915 24 128 GO:0005829
GO:0005960
GO:0019464
AF-A0A523JRE4-F1-model_v4 Glycine cleavage system H protein 0.99 4 128 GO:0005737
GO:0005960
GO:0019464
AF-A0LDQ0-F1-model_v4 Glycine cleavage system H protein 0.9898 4 128 GO:0005829
GO:0005960
GO:0019464
AF-A0A7W1MKK6-F1-model_v4 deleted 0.9892 5 128
AF-A0A424YHP9-F1-model_v4 deleted 0.9891 4 128

Map