F222200

General Info

Members Datasets Scaffolds Average Seq Length
155 101 310 93

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_11820266|Ga0105238_118202662
Length 108
Sequence MGQVWGEESPVQELKIEPMGAILDAIHNKLTAQFQPTRLDVEDDSARHHGHAGARPGGESHFNVTIEAQAFAGQPKVARKRMVYRALAAELAGPVHALSVKALAPGES

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
35 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
64 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
78 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
79 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
80 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
81 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
84 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
85 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
92 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
93 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
94 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
95 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
96 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
97 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
98 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
99 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
100 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
101 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0.65
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.1
Nodule 0
Rhizoplane 2.58
Rhizosphere 84.52
Stem 0
Stem Tuber 0
Unclassified 5.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_11820266 3300009551 Bacteria 641
2 Ga0070658_10183830 3300005327 Bacteria 1760
3 Ga0070658_10236552 3300005327 Bacteria 1548
4 Ga0070658_10260544 3300005327 Bacteria 1473
5 Ga0070658_10474544 3300005327 Bacteria 1079
6 Ga0070680_100074604 3300005336 Bacteria 2791
7 Ga0070680_101901853 3300005336 Bacteria 516
8 Ga0070682_101522329 3300005337 Bacteria 576
9 Ga0070661_100646009 3300005344 Bacteria 858
10 Ga0070681_10035758 3300005458 Bacteria 4989
11 Ga0070679_100795802 3300005530 Bacteria 889
12 Ga0070686_100640177 3300005544 Bacteria 842
13 Ga0070665_100052410 3300005548 Bacteria 4092
14 Ga0068855_100029843 3300005563 Bacteria 6521
15 Ga0068855_100905298 3300005563 Bacteria 932
16 Ga0070664_101454282 3300005564 Bacteria 648
17 Ga0068854_100085844 3300005578 Bacteria 2332
18 Ga0068856_100242391 3300005614 Bacteria 1818
19 Ga0068856_100996869 3300005614 Bacteria 856
20 Ga0068852_100062527 3300005616 Bacteria 3238
21 Ga0068852_101193276 3300005616 Bacteria 782
22 Ga0068859_102448668 3300005617 Bacteria 575
23 Ga0068863_101557799 3300005841 Bacteria 670
24 Ga0068858_100923283 3300005842 Bacteria 854
25 Ga0075365_10185045 3300006038 Bacteria 1457
26 Ga0075363_100131187 3300006048 Bacteria 1405
27 Ga0075362_10026944 3300006177 Bacteria 2458
28 Ga0075370_10297433 3300006353 Bacteria 960
29 Ga0068865_100002854 3300006881 Bacteria 10291
30 Ga0097620_102449644 3300006931 Bacteria 575
31 Ga0105240_10040175 3300009093 Bacteria 5988
32 Ga0105240_10139469 3300009093 Bacteria 2900
33 Ga0105240_10329422 3300009093 Bacteria 1738
34 Ga0105240_11048299 3300009093 Bacteria 870
35 Ga0105245_10492900 3300009098 Bacteria 1240
36 Ga0105245_12162971 3300009098 Bacteria 610
37 Ga0105248_11922720 3300009177 Bacteria 672
38 Ga0105237_10323153 3300009545 Bacteria 1547
39 Ga0105238_10315249 3300009551 Bacteria 1549
40 Ga0105238_11493108 3300009551 Bacteria 704
41 Ga0105239_10264098 3300010375 Bacteria 1935
42 Ga0105239_10800609 3300010375 Bacteria 1080
43 Ga0157370_10414189 3300013104 Bacteria 1240
44 Ga0157369_10403028 3300013105 Bacteria 1419
45 Ga0157369_10865915 3300013105 Bacteria 927
46 Ga0157369_11293987 3300013105 Bacteria 743
47 Ga0163162_10875072 3300013306 Bacteria 1013
48 Ga0157372_10364471 3300013307 Bacteria 1684
49 Ga0157372_12550469 3300013307 Bacteria 587
50 Ga0163163_10817973 3300014325 Bacteria 995
51 Ga0163163_12596976 3300014325 Bacteria 564
52 Ga0182007_10151749 3300015262 Bacteria 788
53 Ga0206354_10047514 3300020081 Bacteria 526
54 Ga0209148_1017561 3300025254 Bacteria 1212
55 Ga0207705_10165830 3300025909 Bacteria 1661
56 Ga0207705_10215582 3300025909 Bacteria 1457
57 Ga0207705_10336117 3300025909 Bacteria 1162
58 Ga0207705_10346466 3300025909 Bacteria 1144
59 Ga0207705_10583305 3300025909 Bacteria 869
60 Ga0207707_10063944 3300025912 Bacteria 3202
61 Ga0207695_10026239 3300025913 Bacteria 6504
62 Ga0207695_10049323 3300025913 Bacteria 4440
63 Ga0207695_10094222 3300025913 Bacteria 3002
64 Ga0207695_10128090 3300025913 Bacteria 2498
65 Ga0207695_10934564 3300025913 Bacteria 747
66 Ga0207671_10214479 3300025914 Bacteria 1506
67 Ga0207660_10169454 3300025917 Bacteria 1689
68 Ga0207660_11181288 3300025917 Bacteria 623
69 Ga0207649_10953581 3300025920 Bacteria 674
70 Ga0207694_10006417 3300025924 Bacteria 8961
71 Ga0207694_10471213 3300025924 Bacteria 1050
72 Ga0207687_10337381 3300025927 Bacteria 1224
73 Ga0207704_10000754 3300025938 Bacteria 14276
74 Ga0207711_10001631 3300025941 Bacteria 20704
75 Ga0207661_11655924 3300025944 Bacteria 585
76 Ga0207667_10010996 3300025949 Bacteria 10546
77 Ga0207667_10318869 3300025949 Bacteria 1587
78 Ga0207667_10544505 3300025949 Bacteria 1174
79 Ga0207667_10813320 3300025949 Bacteria 930
80 Ga0207640_10151104 3300025981 Bacteria 1706
81 Ga0207703_10629028 3300026035 Bacteria 1017
82 Ga0207703_10993826 3300026035 Bacteria 805
83 Ga0207639_11607129 3300026041 Bacteria 610
84 Ga0207702_10883332 3300026078 Bacteria 885
85 Ga0207702_12253583 3300026078 Bacteria 533
86 Ga0207641_11835703 3300026088 Bacteria 608
87 Ga0207698_10518330 3300026142 Bacteria 1163
88 Ga0268266_10068212 3300028379 Bacteria 3079
89 Ga0307517_10521138 3300028786 Bacteria 600
90 Ga0265331_10000816 3300031250 Bacteria 25712
91 Ga0265327_10000179 3300031251 Bacteria 135005
92 Ga0265327_10069180 3300031251 Bacteria 1773
93 Ga0307513_10388402 3300031456 Bacteria 1133
94 Ga0307406_11211734 3300031901 Bacteria 656
95 Ga0307412_10841518 3300031911 Bacteria 800
96 Ga0307416_103880573 3300032002 Bacteria 501
97 Ga0307510_10586131 3300033180 Bacteria 565
98 Ga0373947_0048401 3300035725 Bacteria 2551
99 Ga0395899_0002194 3300037312 Bacteria 16021
100 Ga0395899_0539508 3300037312 Bacteria 751
101 Ga0395900_0000006 3300037418 Bacteria 495364
102 Ga0395900_0521164 3300037418 Bacteria 1136
103 Ga0395900_0836311 3300037418 Bacteria 847
104 Ga0395900_0884396 3300037418 Bacteria 817
105 Ga0395898_0009606 3300037466 Bacteria 10155
106 Ga0395898_0140484 3300037466 Bacteria 2312
107 Ga0395898_1394851 3300037466 Bacteria 628
108 Ga0395898_1802606 3300037466 Bacteria 533
109 Ga0395905_0017458 3300037471 Bacteria 6813
110 Ga0395905_0019501 3300037471 Bacteria 6427
111 Ga0395905_0165368 3300037471 Bacteria 2079
112 Ga0395905_0244777 3300037471 Bacteria 1675
113 Ga0395905_0829969 3300037471 Bacteria 827
114 Ga0395905_1016667 3300037471 Bacteria 732
115 Ga0395905_1558684 3300037471 Bacteria 565
116 Ga0395905_1681100 3300037471 Bacteria 540
117 Ga0395901_0000001 3300038443 Bacteria 800383
118 Ga0395901_0182010 3300038443 Bacteria 2204
119 Ga0436365_0452232 3300039437 Bacteria 1547
120 Ga0436365_0485898 3300039437 Unclassified 584
121 Ga0451847_0591998 3300041503 Unclassified 510
122 Ga0466965_0127029 3300044683 Bacteria 1320
123 Ga0466964_0847299 3300044706 Bacteria 520
124 Ga0466968_0177923 3300044735 Bacteria 988
125 Ga0466957_1158819 3300044842 Bacteria 558
126 Ga0466967_2016669 3300045976 Bacteria 574
127 Ga0495583_0386156 3300046506 Unclassified 551
128 Ga0495686_0254873 3300047472 Unclassified 985
129 Ga0495686_0545257 3300047472 Unclassified 606
130 Ga0496101_0319451 3300048904 Bacteria 1218
131 Ga0496107_0011472 3300048910 Bacteria 6173
132 Ga0496112_0012716 3300048915 Bacteria 7740
133 Ga0496114_0643618 3300048917 Bacteria 933
134 Ga0496121_0003106 3300048924 Bacteria 24005
135 Ga0496126_0019131 3300048929 Bacteria 6754
136 Ga0501031_0752841 3300049568 Bacteria 625
137 Ga0501038_0027659 3300049574 Bacteria 5043
138 Ga0501040_0459335 3300049576 Bacteria 917
139 Ga0501047_0022497 3300049581 Bacteria 6054
140 Ga0501047_0027767 3300049581 Bacteria 5453
141 Ga0501047_0110035 3300049581 Bacteria 2638
142 Ga0501047_1232895 3300049581 Unclassified 562
143 Ga0501048_0782517 3300049582 Bacteria 685
144 Ga0501080_1888256 3300049742 Unclassified 500
145 Ga0501083_0054406 3300049744 Bacteria 2686
146 Ga0501044_0396250 3300049823 Bacteria 1294
147 Ga0495612_0202526 3300053078 Bacteria 876
148 Ga0500635_0000115 3300053080 Bacteria 47775
149 Ga0500607_015888 3300053121 Bacteria 4331
150 Ga0500559_0378188 3300053136 Bacteria 660
151 Ga0500603_009840 3300053150 Bacteria 2146
152 Ga0500636_0056485 3300053177 Bacteria 2299
153 Ga0500637_0013619 3300053178 Bacteria 4270
154 Ga0530510_0933004 3300061734 Unclassified 664
155 2644000590 2643221598 Bacteria 4578346
156 Ga0105238_11820266
157 Ga0070658_10183830
158 Ga0070658_10236552
159 Ga0070658_10260544
160 Ga0070658_10474544
161 Ga0070680_100074604
162 Ga0070680_101901853
163 Ga0070682_101522329
164 Ga0070661_100646009
165 Ga0070681_10035758
166 Ga0070679_100795802
167 Ga0070686_100640177
168 Ga0070665_100052410
169 Ga0068855_100029843
170 Ga0068855_100905298
171 Ga0070664_101454282
172 Ga0068854_100085844
173 Ga0068856_100242391
174 Ga0068856_100996869
175 Ga0068852_100062527
176 Ga0068852_101193276
177 Ga0068859_102448668
178 Ga0068863_101557799
179 Ga0068858_100923283
180 Ga0075365_10185045
181 Ga0075363_100131187
182 Ga0075362_10026944
183 Ga0075370_10297433
184 Ga0068865_100002854
185 Ga0097620_102449644
186 Ga0105240_10040175
187 Ga0105240_10139469
188 Ga0105240_10329422
189 Ga0105240_11048299
190 Ga0105245_10492900
191 Ga0105245_12162971
192 Ga0105248_11922720
193 Ga0105237_10323153
194 Ga0105238_10315249
195 Ga0105238_11493108
196 Ga0105239_10264098
197 Ga0105239_10800609
198 Ga0157370_10414189
199 Ga0157369_10403028
200 Ga0157369_10865915
201 Ga0157369_11293987
202 Ga0163162_10875072
203 Ga0157372_10364471
204 Ga0157372_12550469
205 Ga0163163_10817973
206 Ga0163163_12596976
207 Ga0182007_10151749
208 Ga0206354_10047514
209 Ga0209148_1017561
210 Ga0207705_10165830
211 Ga0207705_10215582
212 Ga0207705_10336117
213 Ga0207705_10346466
214 Ga0207705_10583305
215 Ga0207707_10063944
216 Ga0207695_10026239
217 Ga0207695_10049323
218 Ga0207695_10094222
219 Ga0207695_10128090
220 Ga0207695_10934564
221 Ga0207671_10214479
222 Ga0207660_10169454
223 Ga0207660_11181288
224 Ga0207649_10953581
225 Ga0207694_10006417
226 Ga0207694_10471213
227 Ga0207687_10337381
228 Ga0207704_10000754
229 Ga0207711_10001631
230 Ga0207661_11655924
231 Ga0207667_10010996
232 Ga0207667_10318869
233 Ga0207667_10544505
234 Ga0207667_10813320
235 Ga0207640_10151104
236 Ga0207703_10629028
237 Ga0207703_10993826
238 Ga0207639_11607129
239 Ga0207702_10883332
240 Ga0207702_12253583
241 Ga0207641_11835703
242 Ga0207698_10518330
243 Ga0268266_10068212
244 Ga0307517_10521138
245 Ga0265331_10000816
246 Ga0265327_10000179
247 Ga0265327_10069180
248 Ga0307513_10388402
249 Ga0307406_11211734
250 Ga0307412_10841518
251 Ga0307416_103880573
252 Ga0307510_10586131
253 Ga0373947_0048401
254 Ga0395899_0002194
255 Ga0395899_0539508
256 Ga0395900_0000006
257 Ga0395900_0521164
258 Ga0395900_0836311
259 Ga0395900_0884396
260 Ga0395898_0009606
261 Ga0395898_0140484
262 Ga0395898_1394851
263 Ga0395898_1802606
264 Ga0395905_0017458
265 Ga0395905_0019501
266 Ga0395905_0165368
267 Ga0395905_0244777
268 Ga0395905_0829969
269 Ga0395905_1016667
270 Ga0395905_1558684
271 Ga0395905_1681100
272 Ga0395901_0000001
273 Ga0395901_0182010
274 Ga0436365_0452232
275 Ga0436365_0485898
276 Ga0451847_0591998
277 Ga0466965_0127029
278 Ga0466964_0847299
279 Ga0466968_0177923
280 Ga0466957_1158819
281 Ga0466967_2016669
282 Ga0495583_0386156
283 Ga0495686_0254873
284 Ga0495686_0545257
285 Ga0496101_0319451
286 Ga0496107_0011472
287 Ga0496112_0012716
288 Ga0496114_0643618
289 Ga0496121_0003106
290 Ga0496126_0019131
291 Ga0501031_0752841
292 Ga0501038_0027659
293 Ga0501040_0459335
294 Ga0501047_0022497
295 Ga0501047_0027767
296 Ga0501047_0110035
297 Ga0501047_1232895
298 Ga0501048_0782517
299 Ga0501080_1888256
300 Ga0501083_0054406
301 Ga0501044_0396250
302 Ga0495612_0202526
303 Ga0500635_0000115
304 Ga0500607_015888
305 Ga0500559_0378188
306 Ga0500603_009840
307 Ga0500636_0056485
308 Ga0500637_0013619
309 Ga0530510_0933004
310 2644000590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

30

107

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.9366 4 90
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.9278 1 87
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.9126 1 87
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8872 1 88
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.883 4 90
ID Description Score Start End Superfamily
af_Q9H3K6_1_86_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9206 6 89 3.10.20.90
af_Q9USK1_28_105_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9161 6 86 3.30.300.90
af_Q5AKW1_24_116_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9136 2 87 3.30.300.90
af_P0A9W6_1_84_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9115 6 89 3.30.300.90
af_Q8I3V0_1_83_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9106 4 89 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A258C5Z9-F1-model_v4 deleted 0.9782 1 88
AF-A0A7T4VJK0-F1-model_v4 deleted 0.9595 6 89
AF-A0A2E5VAN7-F1-model_v4 BolA family transcriptional regulator 0.9571 3 87 GO:0016226
AF-A0A6A5KV05-F1-model_v4 deleted 0.9531 3 89
AF-Q05HZ1-F1-model_v4 BolA family transcriptional regulator 0.952 6 90 GO:0016226

Map