F221939

General Info

Members Datasets Scaffolds Average Seq Length
155 100 155 124

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_101454111|Ga0097621_1014541111
Length 149
Sequence LLNVSRFAGKKTGEGQTEHLKRKIDMNTTLQKENQTTTNDQPQNFVAPEVNIFETKDGYVLEAEMPGVSKEGLGITLEDNELTIVGHRKHETYPGETLFQESRAADYRRVFELDPAIDSAKISAKIEQGVLTLTLPKSERVKPRKIVVE

Samples

Sample ID Description Type Environment
1 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
41 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
66 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
67 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
68 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.61
Metatranscriptomes 28.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.65
Rhizosphere 98.06
Stem 0
Stem Tuber 0
Unclassified 1.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007429J51699_1114288 3300003579 Unclassified 640
2 Ga0058860_11810111 3300004801 Unclassified 723
3 Ga0070658_10060503 3300005327 Bacteria 3085
4 Ga0070689_100230698 3300005340 Bacteria 1522
5 Ga0070687_100972179 3300005343 Unclassified 613
6 Ga0070671_100590915 3300005355 Unclassified 959
7 Ga0070674_100232169 3300005356 Unclassified 1440
8 Ga0070673_101345374 3300005364 Unclassified 671
9 Ga0070673_101750207 3300005364 Unclassified 588
10 Ga0070713_100140089 3300005436 Bacteria 2142
11 Ga0070713_100955014 3300005436 Bacteria 826
12 Ga0070662_100816799 3300005457 Unclassified 793
13 Ga0068867_101586416 3300005459 Bacteria 611
14 Ga0070684_101757238 3300005535 Bacteria 585
15 Ga0070697_101746318 3300005536 Unclassified 557
16 Ga0068853_100290180 3300005539 Unclassified 1510
17 Ga0068853_101641255 3300005539 Unclassified 623
18 Ga0070686_100557151 3300005544 Bacteria 897
19 Ga0068857_100845779 3300005577 Bacteria 875
20 Ga0068859_100396310 3300005617 Bacteria 1476
21 Ga0068863_100010582 3300005841 Bacteria 8955
22 Ga0068863_100423648 3300005841 Unclassified 1304
23 Ga0068863_100630073 3300005841 Bacteria 1063
24 Ga0068862_100429247 3300005844 Bacteria 1242
25 Ga0070712_101643593 3300006175 Unclassified 562
26 Ga0097621_100295661 3300006237 Bacteria 1429
27 Ga0097621_101454111 3300006237 Unclassified 650
28 Ga0075434_100518222 3300006871 Unclassified 1213
29 Ga0097620_100396324 3300006931 Bacteria 1476
30 Ga0075435_100714812 3300007076 Bacteria 871
31 Ga0075435_100724702 3300007076 Unclassified 865
32 Ga0099794_10052825 3300007265 Unclassified 1959
33 Ga0105240_10000380 3300009093 Bacteria 83232
34 Ga0111539_10136120 3300009094 Bacteria 2877
35 Ga0111539_10500418 3300009094 Unclassified 1415
36 Ga0105242_10164811 3300009176 Unclassified 1943
37 Ga0105242_11082499 3300009176 Bacteria 814
38 Ga0105242_12713941 3300009176 Unclassified 545
39 Ga0105248_11675496 3300009177 Unclassified 721
40 Ga0105239_10312508 3300010375 Unclassified 1771
41 Ga0105239_12883391 3300010375 Unclassified 561
42 Ga0157374_10073809 3300013296 Unclassified 3220
43 Ga0157374_10078782 3300013296 Bacteria 3121
44 Ga0157378_12847594 3300013297 Bacteria 536
45 Ga0163162_10993234 3300013306 Unclassified 949
46 Ga0157372_11926633 3300013307 Bacteria 679
47 Ga0163163_10000010 3300014325 Bacteria 264773
48 Ga0157376_10104435 3300014969 Bacteria 2483
49 Ga0157376_10681750 3300014969 Bacteria 1031
50 Ga0197907_10325100 3300020069 Unclassified 990
51 Ga0197907_10366336 3300020069 Bacteria 787
52 Ga0197907_10763025 3300020069 Unclassified 892
53 Ga0206356_11015902 3300020070 Bacteria 1020
54 Ga0206356_11709711 3300020070 Unclassified 689
55 Ga0206349_1220528 3300020075 Bacteria 934
56 Ga0206349_1495440 3300020075 Unclassified 531
57 Ga0206349_1868783 3300020075 Unclassified 987
58 Ga0206355_1235935 3300020076 Unclassified 972
59 Ga0206351_10095060 3300020077 Bacteria 1016
60 Ga0206351_10272057 3300020077 Bacteria 1026
61 Ga0206351_10465879 3300020077 Bacteria 630
62 Ga0206351_10492569 3300020077 Unclassified 505
63 Ga0206351_10574447 3300020077 Unclassified 985
64 Ga0206351_10588532 3300020077 Bacteria 734
65 Ga0206351_10822703 3300020077 Unclassified 925
66 Ga0206351_10940271 3300020077 Unclassified 700
67 Ga0206352_10246122 3300020078 Bacteria 999
68 Ga0206352_10275728 3300020078 Bacteria 667
69 Ga0206352_11218816 3300020078 Unclassified 958
70 Ga0206350_10151500 3300020080 Unclassified 942
71 Ga0206350_10268216 3300020080 Unclassified 916
72 Ga0206350_10406434 3300020080 Unclassified 961
73 Ga0206350_10975572 3300020080 Unclassified 884
74 Ga0206350_11044642 3300020080 Unclassified 508
75 Ga0206350_11085392 3300020080 Bacteria 922
76 Ga0206350_11180168 3300020080 Bacteria 1185
77 Ga0206350_11582310 3300020080 Unclassified 998
78 Ga0206354_10646490 3300020081 Unclassified 587
79 Ga0206354_11609197 3300020081 Unclassified 522
80 Ga0206353_10867363 3300020082 Bacteria 1001
81 Ga0154015_1082894 3300020610 Bacteria 1056
82 Ga0154015_1245896 3300020610 Unclassified 504
83 Ga0224712_10141567 3300022467 Unclassified 1059
84 Ga0224712_10154037 3300022467 Bacteria 1020
85 Ga0224712_10160849 3300022467 Bacteria 1001
86 Ga0224712_10166064 3300022467 Bacteria 987
87 Ga0224712_10181222 3300022467 Unclassified 949
88 Ga0224712_10287753 3300022467 Unclassified 766
89 Ga0207695_10000502 3300025913 Bacteria 83225
90 Ga0207700_10559820 3300025928 Unclassified 1015
91 Ga0207644_11485738 3300025931 Unclassified 569
92 Ga0207706_10431343 3300025933 Unclassified 1141
93 Ga0207670_10174105 3300025936 Bacteria 1616
94 Ga0207669_10862344 3300025937 Unclassified 754
95 Ga0207711_10605399 3300025941 Unclassified 1022
96 Ga0207668_10600034 3300025972 Unclassified 959
97 Ga0207639_10169598 3300026041 Unclassified 1847
98 Ga0207639_11523127 3300026041 Unclassified 628
99 Ga0207641_10003211 3300026088 Bacteria 14636
100 Ga0207641_10601759 3300026088 Bacteria 1076
101 Ga0207641_10605646 3300026088 Unclassified 1073
102 Ga0207641_11133609 3300026088 Unclassified 781
103 Ga0207648_10946248 3300026089 Unclassified 806
104 Ga0207698_10235368 3300026142 Bacteria 1665
105 Ga0268265_10975122 3300028380 Bacteria 836
106 Ga0265337_1012022 3300028556 Unclassified 2958
107 Ga0265338_10269398 3300028800 Bacteria 1248
108 Ga0307511_10216189 3300030521 Bacteria 970
109 Ga0265314_10262997 3300031711 Unclassified 984
110 Ga0373953_0167761 3300035117 Bacteria 945
111 Ga0373954_0367690 3300035118 Unclassified 710
112 Ga0373956_0469737 3300035119 Unclassified 600
113 Ga0373924_0123614 3300035410 Unclassified 1124
114 Ga0373927_0566899 3300035695 Bacteria 750
115 Ga0373927_0589804 3300035695 Unclassified 735
116 Ga0373933_0252591 3300035724 Unclassified 1136
117 Ga0373937_1019006 3300036401 Unclassified 777
118 Ga0373937_1141565 3300036401 Bacteria 728
119 Ga0373937_1312772 3300036401 Unclassified 671
120 Ga0451798_0543308 3300041458 Unclassified 615
121 Ga0451577_0002347 3300042876 Bacteria 22758
122 Ga0451577_0035961 3300042876 Bacteria 4461
123 Ga0453684_0005984 3300044712 Bacteria 23559
124 Ga0451576_0156690 3300045051 Bacteria 2376
125 Ga0451576_0301031 3300045051 Bacteria 1677
126 Ga0451576_0365113 3300045051 Unclassified 1512
127 Ga0451576_0833304 3300045051 Bacteria 968
128 Ga0451576_1454146 3300045051 Unclassified 713
129 Ga0495592_0052933 3300046454 Bacteria 3012
130 Ga0495641_0012736 3300046461 Unclassified 4679
131 Ga0495651_0100706 3300046462 Bacteria 2152
132 Ga0495580_0198445 3300046472 Bacteria 1383
133 Ga0495639_0146665 3300046475 Unclassified 1137
134 Ga0495630_0367858 3300046517 Bacteria 1101
135 Ga0495640_0064105 3300046533 Unclassified 2486
136 Ga0495586_0172447 3300046535 Bacteria 1222
137 Ga0495645_0347228 3300046543 Bacteria 957
138 Ga0495667_0472295 3300046559 Bacteria 787
139 Ga0495634_0155065 3300046642 Unclassified 1446
140 Ga0495634_0319657 3300046642 Bacteria 935
141 Ga0495599_0082637 3300046678 Bacteria 2006
142 Ga0495658_0002887 3300046683 Bacteria 8632
143 Ga0495669_0225427 3300046684 Bacteria 899
144 Ga0495624_0332666 3300046690 Unclassified 914
145 Ga0495676_0213479 3300047321 Bacteria 1334
146 Ga0495675_0203341 3300047444 Unclassified 1205
147 Ga0495684_0392823 3300047471 Bacteria 976
148 Ga0501310_071666 3300049130 Unclassified 532
149 Ga0501323_095290 3300049539 Unclassified 500
150 Ga0501047_1190810 3300049581 Unclassified 575
151 nmdc:mga08y16_14591_c1 3300050511 Bacteria 8263
152 nmdc:mga08y16_809821_c1 3300050511 Unclassified 929
153 nmdc:mga0n895_481879_c1 3300050512 Unclassified 1251
154 nmdc:mga0rr50_815977_c1 3300050513 Unclassified 796
155 Ga0587075_023264 3300059644 Unclassified 936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100140089 Ga0070713_1001400893 110
2 3300005841 Ga0068863_100630073 Ga0068863_1006300732 110
3 3300014969 Ga0157376_10104435 Ga0157376_101044352 110
4 3300020069 Ga0197907_10325100 Ga0197907_103251002 110
5 3300020076 Ga0206355_1235935 Ga0206355_12359352 110
6 3300025928 Ga0207700_10559820 Ga0207700_105598202 110
7 3300026088 Ga0207641_10601759 Ga0207641_106017592 110
8 3300026088 Ga0207641_11133609 Ga0207641_111336092 110
9 3300035695 Ga0373927_0589804 Ga0373927_0589804_116_514 110
10 3300010375 Ga0105239_12883391 Ga0105239_128833911 112
11 3300014969 Ga0157376_10681750 Ga0157376_106817502 112
12 3300028556 Ga0265337_1012022 Ga0265337_10120223 112
13 3300036401 Ga0373937_1141565 Ga0373937_1141565_182_562 112
14 3300045051 Ga0451576_0301031 Ga0451576_0301031_887_1261 112
15 3300046462 Ga0495651_0100706 Ga0495651_0100706_1689_2069 112
16 3300020069 Ga0197907_10763025 Ga0197907_107630251 118
17 3300020075 Ga0206349_1868783 Ga0206349_18687832 118
18 3300020077 Ga0206351_10272057 Ga0206351_102720572 118
19 3300020078 Ga0206352_10246122 Ga0206352_102461222 118
20 3300020080 Ga0206350_11582310 Ga0206350_115823102 118
21 3300020082 Ga0206353_10867363 Ga0206353_108673632 118
22 3300020610 Ga0154015_1082894 Ga0154015_10828942 118
23 3300022467 Ga0224712_10166064 Ga0224712_101660642 118
24 3300005457 Ga0070662_100816799 Ga0070662_1008167992 120
25 3300005539 Ga0068853_100290180 Ga0068853_1002901803 120
26 3300005544 Ga0070686_100557151 Ga0070686_1005571512 120
27 3300013296 Ga0157374_10073809 Ga0157374_100738094 120
28 3300013297 Ga0157378_12847594 Ga0157378_128475941 120
29 3300013307 Ga0157372_11926633 Ga0157372_119266332 120
30 3300025933 Ga0207706_10431343 Ga0207706_104313432 120
31 3300026041 Ga0207639_10169598 Ga0207639_101695983 120
32 3300005340 Ga0070689_100230698 Ga0070689_1002306982 121
33 3300005436 Ga0070713_100955014 Ga0070713_1009550142 121
34 3300005459 Ga0068867_101586416 Ga0068867_1015864161 121
35 3300005535 Ga0070684_101757238 Ga0070684_1017572381 121
36 3300005844 Ga0068862_100429247 Ga0068862_1004292471 121
37 3300020077 Ga0206351_10588532 Ga0206351_105885321 121
38 3300020080 Ga0206350_11180168 Ga0206350_111801682 121
39 3300022467 Ga0224712_10141567 Ga0224712_101415672 121
40 3300022467 Ga0224712_10154037 Ga0224712_101540372 121
41 3300025936 Ga0207670_10174105 Ga0207670_101741052 121
42 3300026088 Ga0207641_10605646 Ga0207641_106056461 121
43 3300028380 Ga0268265_10975122 Ga0268265_109751221 121
44 3300035117 Ga0373953_0167761 Ga0373953_0167761_473_844 121
45 3300035118 Ga0373954_0367690 Ga0373954_0367690_229_600 121
46 3300035119 Ga0373956_0469737 Ga0373956_0469737_43_414 121
47 3300035410 Ga0373924_0123614 Ga0373924_0123614_155_526 121
48 3300035724 Ga0373933_0252591 Ga0373933_0252591_171_542 121
49 3300036401 Ga0373937_1312772 Ga0373937_1312772_74_445 121
50 3300045051 Ga0451576_0365113 Ga0451576_0365113_67_438 121
51 3300046454 Ga0495592_0052933 Ga0495592_0052933_2055_2483 121
52 3300046642 Ga0495634_0319657 Ga0495634_0319657_522_893 121
53 3300047444 Ga0495675_0203341 Ga0495675_0203341_757_1185 121
54 3300047471 Ga0495684_0392823 Ga0495684_0392823_243_614 121
55 3300005327 Ga0070658_10060503 Ga0070658_100605035 122
56 3300005364 Ga0070673_101750207 Ga0070673_1017502071 122
57 3300005536 Ga0070697_101746318 Ga0070697_1017463181 122
58 3300005617 Ga0068859_100396310 Ga0068859_1003963102 122
59 3300006175 Ga0070712_101643593 Ga0070712_1016435931 122
60 3300006931 Ga0097620_100396324 Ga0097620_1003963242 122
61 3300007076 Ga0075435_100724702 Ga0075435_1007247022 122
62 3300014325 Ga0163163_10000010 Ga0163163_10000010148 122
63 3300020069 Ga0197907_10366336 Ga0197907_103663361 122
64 3300020070 Ga0206356_11015902 Ga0206356_110159022 122
65 3300020077 Ga0206351_10492569 Ga0206351_104925691 122
66 3300020078 Ga0206352_11218816 Ga0206352_112188162 122
67 3300020080 Ga0206350_11085392 Ga0206350_110853922 122
68 3300020081 Ga0206354_10646490 Ga0206354_106464901 122
69 3300022467 Ga0224712_10160849 Ga0224712_101608491 122
70 3300026089 Ga0207648_10946248 Ga0207648_109462481 122
71 3300028800 Ga0265338_10269398 Ga0265338_102693982 122
72 3300030521 Ga0307511_10216189 Ga0307511_102161891 122
73 3300035695 Ga0373927_0566899 Ga0373927_0566899_148_519 122
74 3300036401 Ga0373937_1019006 Ga0373937_1019006_154_528 122
75 3300046472 Ga0495580_0198445 Ga0495580_0198445_714_1085 122
76 3300046517 Ga0495630_0367858 Ga0495630_0367858_393_767 122
77 3300050513 nmdc:mga0rr50_815977_c1 nmdc:mga0rr50_815977_c1_306_683 122
78 3300004801 Ga0058860_11810111 Ga0058860_118101111 123
79 3300005343 Ga0070687_100972179 Ga0070687_1009721791 123
80 3300005355 Ga0070671_100590915 Ga0070671_1005909152 123
81 3300005539 Ga0068853_101641255 Ga0068853_1016412551 123
82 3300005577 Ga0068857_100845779 Ga0068857_1008457792 123
83 3300005841 Ga0068863_100010582 Ga0068863_1000105823 123
84 3300005841 Ga0068863_100423648 Ga0068863_1004236482 123
85 3300006237 Ga0097621_100295661 Ga0097621_1002956612 123
86 3300006237 Ga0097621_101454111 Ga0097621_1014541111 123
87 3300006871 Ga0075434_100518222 Ga0075434_1005182222 123
88 3300007076 Ga0075435_100714812 Ga0075435_1007148122 123
89 3300007265 Ga0099794_10052825 Ga0099794_100528253 123
90 3300009093 Ga0105240_10000380 Ga0105240_1000038043 123
91 3300009094 Ga0111539_10136120 Ga0111539_101361203 123
92 3300009094 Ga0111539_10500418 Ga0111539_105004183 123
93 3300009176 Ga0105242_10164811 Ga0105242_101648113 123
94 3300009176 Ga0105242_11082499 Ga0105242_110824991 123
95 3300009176 Ga0105242_12713941 Ga0105242_127139411 123
96 3300009177 Ga0105248_11675496 Ga0105248_116754962 123
97 3300010375 Ga0105239_10312508 Ga0105239_103125082 123
98 3300013296 Ga0157374_10078782 Ga0157374_100787823 123
99 3300013306 Ga0163162_10993234 Ga0163162_109932342 123
100 3300020070 Ga0206356_11709711 Ga0206356_117097111 123
101 3300020075 Ga0206349_1220528 Ga0206349_12205281 123
102 3300020075 Ga0206349_1495440 Ga0206349_14954401 123
103 3300020077 Ga0206351_10095060 Ga0206351_100950602 123
104 3300020077 Ga0206351_10465879 Ga0206351_104658792 123
105 3300020077 Ga0206351_10574447 Ga0206351_105744472 123
106 3300020077 Ga0206351_10822703 Ga0206351_108227031 123
107 3300020077 Ga0206351_10940271 Ga0206351_109402712 123
108 3300020078 Ga0206352_10275728 Ga0206352_102757282 123
109 3300020080 Ga0206350_10151500 Ga0206350_101515002 123
110 3300020080 Ga0206350_10268216 Ga0206350_102682162 123
111 3300020080 Ga0206350_10406434 Ga0206350_104064341 123
112 3300020080 Ga0206350_10975572 Ga0206350_109755722 123
113 3300020080 Ga0206350_11044642 Ga0206350_110446421 123
114 3300020081 Ga0206354_11609197 Ga0206354_116091971 123
115 3300020610 Ga0154015_1245896 Ga0154015_12458961 123
116 3300022467 Ga0224712_10181222 Ga0224712_101812222 123
117 3300022467 Ga0224712_10287753 Ga0224712_102877532 123
118 3300025913 Ga0207695_10000502 Ga0207695_1000050235 123
119 3300025931 Ga0207644_11485738 Ga0207644_114857382 123
120 3300025941 Ga0207711_10605399 Ga0207711_106053991 123
121 3300026041 Ga0207639_11523127 Ga0207639_115231272 123
122 3300026088 Ga0207641_10003211 Ga0207641_1000321114 123
123 3300026142 Ga0207698_10235368 Ga0207698_102353682 123
124 3300031711 Ga0265314_10262997 Ga0265314_102629972 123
125 3300041458 Ga0451798_0543308 Ga0451798_0543308_88_513 123
126 3300042876 Ga0451577_0002347 Ga0451577_0002347_13917_14303 123
127 3300042876 Ga0451577_0035961 Ga0451577_0035961_1179_1556 123
128 3300044712 Ga0453684_0005984 Ga0453684_0005984_18732_19118 123
129 3300045051 Ga0451576_0156690 Ga0451576_0156690_914_1288 123
130 3300045051 Ga0451576_0833304 Ga0451576_0833304_22_396 123
131 3300045051 Ga0451576_1454146 Ga0451576_1454146_85_468 123
132 3300046461 Ga0495641_0012736 Ga0495641_0012736_518_889 123
133 3300046475 Ga0495639_0146665 Ga0495639_0146665_625_996 123
134 3300046533 Ga0495640_0064105 Ga0495640_0064105_122_493 123
135 3300046535 Ga0495586_0172447 Ga0495586_0172447_793_1164 123
136 3300046543 Ga0495645_0347228 Ga0495645_0347228_440_820 123
137 3300046559 Ga0495667_0472295 Ga0495667_0472295_314_697 123
138 3300046642 Ga0495634_0155065 Ga0495634_0155065_265_636 123
139 3300046678 Ga0495599_0082637 Ga0495599_0082637_829_1209 123
140 3300046683 Ga0495658_0002887 Ga0495658_0002887_5782_6153 123
141 3300046684 Ga0495669_0225427 Ga0495669_0225427_203_586 123
142 3300046690 Ga0495624_0332666 Ga0495624_0332666_521_892 123
143 3300047321 Ga0495676_0213479 Ga0495676_0213479_111_482 123
144 3300049130 Ga0501310_071666 Ga0501310_071666_99_479 123
145 3300049539 Ga0501323_095290 Ga0501323_095290_97_480 123
146 3300049581 Ga0501047_1190810 Ga0501047_1190810_101_481 123
147 3300050511 nmdc:mga08y16_14591_c1 nmdc:mga08y16_14591_c1_7306_7692 123
148 3300050511 nmdc:mga08y16_809821_c1 nmdc:mga08y16_809821_c1_41_427 123
149 3300050512 nmdc:mga0n895_481879_c1 nmdc:mga0n895_481879_c1_331_711 123
150 3300059644 Ga0587075_023264 Ga0587075_023264_499_915 123
151 3300003579 Ga0007429J51699_1114288 Ga0007429J51699_11142882 124
152 3300005356 Ga0070674_100232169 Ga0070674_1002321692 124
153 3300005364 Ga0070673_101345374 Ga0070673_1013453741 124
154 3300025937 Ga0207669_10862344 Ga0207669_108623442 124
155 3300025972 Ga0207668_10600034 Ga0207668_106000342 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

51

149

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zul-assembly1.cif.gz_A-2 small heat shock protein from mycobacterium marinum m : form-3 0.8821 17 111
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.8784 17 111
5zul-assembly1.cif.gz_C-2 small heat shock protein from mycobacterium marinum m : form-3 0.8727 17 113
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.8715 21 112
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8698 23 112
ID Description Score Start End Superfamily
5ds2D00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8715 21 112 2.60.40.790
af_M9PCC9_52_133_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8675 34 111 2.60.40.790
af_K7L898_13_106_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8584 18 113 2.60.40.790
af_Q4DXK9_8_134_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8572 20 111 2.60.40.790
af_Q9VCC0_206_319_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8557 19 114 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A1E7TT05-F1-model_v4 deleted 0.9182 19 111
AF-A0A7X6K1L1-F1-model_v4 deleted 0.8995 19 120
AF-A0A1G2WPY2-F1-model_v4 SHSP domain-containing protein 0.8922 16 124
AF-A0A3M1V4Z6-F1-model_v4 Hsp20/alpha crystallin family protein 0.8905 19 124
AF-A0A4Q0MV17-F1-model_v4 deleted 0.8852 18 124

Feature Viewer

pLDDT pTM Quality
73.99 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map