F221134

General Info

Members Datasets Scaffolds Average Seq Length
155 110 310 168

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10103761|rootH1_101037613
Length 190
Sequence MLERREQPSALSFKHSAFNVMSKRTAEFWINRLQLATHIEGGAFREIYRSPVLAPLTALPAGFTAERNFCTSIYFLLQHNQFSAFHRIKSDEVWHFYYGDALIVYEIDQQGRLIEHRLGCDPDNSETFQCVITAGNWFAARLAPGGDYSLVGCTVSPGFDFADFELAGREELVRLYPQHAETIKELTIRE

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
29 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
46 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
47 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
48 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
49 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
50 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
51 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
52 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
55 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
56 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
57 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
58 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
59 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
60 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
61 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
62 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
63 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
64 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
65 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
66 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
67 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
76 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
77 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
87 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
88 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
89 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
97 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
98 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
99 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
100 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
101 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
102 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
103 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
104 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
105 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
106 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
107 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
108 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
109 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
110 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.55
Nodule 0
Rhizoplane 0.65
Rhizosphere 75.48
Stem 0
Stem Tuber 0
Unclassified 15.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10103761 3300003316 Unclassified 2341
2 rootH1_10268921 3300003323 Bacteria 2703
3 Ga0068869_100233921 3300005334 Bacteria 1461
4 Ga0070673_100693902 3300005364 Bacteria 934
5 Ga0070681_10727075 3300005458 Bacteria 909
6 Ga0068853_100137905 3300005539 Bacteria 2188
7 Ga0068853_100416424 3300005539 Bacteria 1259
8 Ga0068853_101665544 3300005539 Bacteria 618
9 Ga0070665_100000074 3300005548 Bacteria 192944
10 Ga0068855_100043678 3300005563 Bacteria 5307
11 Ga0068855_100336756 3300005563 Bacteria 1664
12 Ga0068857_100003092 3300005577 Bacteria 13769
13 Ga0068857_100344354 3300005577 Unclassified 1379
14 Ga0068854_100033104 3300005578 Bacteria 3602
15 Ga0068854_100391743 3300005578 Bacteria 1147
16 Ga0068856_100033327 3300005614 Bacteria 5042
17 Ga0068856_100267809 3300005614 Unclassified 1724
18 Ga0068856_100553852 3300005614 Bacteria 1171
19 Ga0068852_100011987 3300005616 Bacteria 6557
20 Ga0068852_100480049 3300005616 Bacteria 1235
21 Ga0068859_100911516 3300005617 Unclassified 963
22 Ga0068863_100799222 3300005841 Bacteria 941
23 Ga0068860_100727619 3300005843 Unclassified 1003
24 Ga0075366_10014291 3300006195 Bacteria 4534
25 Ga0097620_100911271 3300006931 Unclassified 963
26 Ga0105240_10000753 3300009093 Bacteria 59090
27 Ga0105240_10102112 3300009093 Bacteria 3486
28 Ga0114129_10022293 3300009147 Bacteria 8991
29 Ga0105241_10001459 3300009174 Bacteria 18127
30 Ga0105241_10060274 3300009174 Bacteria 2919
31 Ga0105237_10031297 3300009545 Bacteria 5396
32 Ga0105237_10033454 3300009545 Bacteria 5207
33 Ga0105237_10047698 3300009545 Bacteria 4306
34 Ga0105237_10469064 3300009545 Bacteria 1265
35 Ga0105238_10028084 3300009551 Bacteria 5732
36 Ga0105238_10648011 3300009551 Unclassified 1066
37 Ga0105239_10009758 3300010375 Bacteria 10793
38 Ga0105239_11190947 3300010375 Bacteria 878
39 Ga0157370_10014717 3300013104 Bacteria 7988
40 Ga0157369_10010536 3300013105 Bacteria 10523
41 Ga0163162_10005006 3300013306 Bacteria 12764
42 Ga0157372_10017386 3300013307 Bacteria 7718
43 Ga0157372_10047287 3300013307 Bacteria 4780
44 Ga0213876_10362573 3300021384 Unclassified 771
45 Ga0209646_1001253 3300025246 Bacteria 7204
46 Ga0207647_10024479 3300025904 Unclassified 3980
47 Ga0207654_10100795 3300025911 Bacteria 1779
48 Ga0207707_10875433 3300025912 Unclassified 744
49 Ga0207695_10000982 3300025913 Bacteria 50708
50 Ga0207695_10121488 3300025913 Bacteria 2579
51 Ga0207695_10160378 3300025913 Bacteria 2181
52 Ga0207671_10003756 3300025914 Bacteria 14949
53 Ga0207671_10008024 3300025914 Bacteria 9033
54 Ga0207671_10026486 3300025914 Bacteria 4343
55 Ga0207671_10041017 3300025914 Bacteria 3425
56 Ga0207671_10259905 3300025914 Unclassified 1366
57 Ga0207694_10038358 3300025924 Bacteria 3684
58 Ga0207694_10063398 3300025924 Bacteria 2879
59 Ga0207667_10004842 3300025949 Bacteria 16459
60 Ga0207667_10145511 3300025949 Unclassified 2440
61 Ga0207640_10024860 3300025981 Bacteria 3619
62 Ga0207639_10398832 3300026041 Bacteria 1239
63 Ga0207702_10057121 3300026078 Unclassified 3316
64 Ga0207702_10211039 3300026078 Bacteria 1805
65 Ga0207702_10404234 3300026078 Bacteria 1318
66 Ga0207674_10009764 3300026116 Bacteria 10932
67 Ga0207674_10035428 3300026116 Bacteria 5208
68 Ga0207698_10001649 3300026142 Bacteria 13022
69 Ga0207698_10312245 3300026142 Bacteria 1468
70 Ga0268266_10000010 3300028379 Bacteria 1030233
71 Ga0268265_10468655 3300028380 Unclassified 1180
72 Ga0268265_10804128 3300028380 Bacteria 917
73 Ga0268264_10000052 3300028381 Bacteria 321218
74 Ga0265338_10503718 3300028800 Bacteria 852
75 Ga0265332_10211314 3300031238 Bacteria 805
76 Ga0265339_10000061 3300031249 Bacteria 96584
77 Ga0265316_10000396 3300031344 Bacteria 49712
78 Ga0307513_10230671 3300031456 Bacteria 1664
79 Ga0307513_10508829 3300031456 Bacteria 921
80 Ga0307509_10061028 3300031507 Bacteria 3983
81 Ga0307509_10100951 3300031507 Unclassified 2922
82 Ga0307514_10350742 3300031649 Bacteria 787
83 Ga0265314_10000011 3300031711 Bacteria 445050
84 Ga0316576_10088853 3300031727 Bacteria 2301
85 Ga0316576_10402800 3300031727 Bacteria 1014
86 Ga0373925_0519944 3300037068 Unclassified 978
87 Ga0395905_0029460 3300037471 Bacteria 5172
88 Ga0436365_0210074 3300039437 Bacteria 1231
89 Ga0439465_0004677 3300041413 Bacteria 4416
90 Ga0451807_1515299 3300041486 Bacteria 618
91 Ga0451833_0211006 3300041491 Bacteria 1130
92 Ga0451849_1557616 3300041505 Bacteria 953
93 Ga0451855_0592141 3300041511 Bacteria 981
94 Ga0451853_3150520 3300041512 Bacteria 2637
95 Ga0439449_0025338 3300042007 Bacteria 2218
96 Ga0439457_004854 3300042014 Bacteria 3455
97 Ga0466969_0132834 3300044656 Bacteria 1153
98 Ga0466972_0000023 3300044658 Bacteria 192679
99 Ga0466972_0006531 3300044658 Bacteria 5859
100 Ga0466977_0006959 3300044666 Bacteria 6108
101 Ga0466966_0000028 3300044684 Bacteria 105667
102 Ga0466961_0122879 3300044693 Bacteria 1629
103 Ga0466961_0124648 3300044693 Bacteria 1617
104 Ga0466964_0077786 3300044706 Bacteria 1417
105 Ga0453684_0089865 3300044712 Bacteria 3796
106 Ga0453684_1102454 3300044712 Bacteria 838
107 Ga0466957_0000082 3300044842 Bacteria 38374
108 Ga0466957_0009504 3300044842 Bacteria 5552
109 Ga0466959_0000047 3300045049 Bacteria 86901
110 Ga0451576_0047199 3300045051 Bacteria 4529
111 Ga0495648_0106988 3300046524 Unclassified 1530
112 Ga0495611_0000135 3300046648 Bacteria 51495
113 Ga0495687_000039 3300047443 Bacteria 245077
114 Ga0501032_0113583 3300049569 Bacteria 1792
115 Ga0501032_0228586 3300049569 Archaea 1210
116 Ga0501033_0509675 3300049570 Bacteria 832
117 Ga0501036_0605115 3300049572 Unclassified 909
118 Ga0501039_0014824 3300049575 Archaea 5962
119 Ga0501042_0403508 3300049578 Unclassified 990
120 Ga0501043_0271011 3300049579 Bacteria 1303
121 Ga0501046_0035539 3300049580 Archaea 4015
122 Ga0501047_0040550 3300049581 Bacteria 4503
123 Ga0501047_0196641 3300049581 Bacteria 1878
124 Ga0501047_0936109 3300049581 Unclassified 680
125 Ga0501071_0156842 3300049587 Archaea 1700
126 Ga0501198_042253 3300049649 Bacteria 793
127 Ga0501230_117944 3300049667 Bacteria 585
128 Ga0501225_0005483 3300049705 Bacteria 3722
129 Ga0501080_0137566 3300049742 Bacteria 2260
130 Ga0501083_0344559 3300049744 Bacteria 969
131 Ga0501035_0130431 3300049822 Bacteria 2192
132 Ga0501044_0009279 3300049823 Bacteria 10739
133 nmdc:mga0k408_92466_c1 3300050493 Bacteria 1778
134 nmdc:mga05p37_16038_c1 3300050507 Bacteria 9016
135 Ga0500578_0000027 3300053086 Bacteria 144362
136 Ga0500578_0071267 3300053086 Bacteria 2215
137 Ga0500578_0431043 3300053086 Unclassified 754
138 Ga0500578_0539829 3300053086 Bacteria 650
139 Ga0500646_0014922 3300053090 Bacteria 2020
140 Ga0500646_0103075 3300053090 Bacteria 898
141 Ga0500583_0000080 3300053092 Bacteria 55700
142 Ga0500583_0001678 3300053092 Bacteria 6461
143 Ga0500651_0434679 3300053093 Bacteria 732
144 Ga0500650_0052819 3300053098 Bacteria 1890
145 Ga0500594_0209081 3300053118 Bacteria 643
146 Ga0500642_0024435 3300053130 Bacteria 2442
147 Ga0500652_013585 3300053131 Bacteria 2888
148 Ga0500568_0049144 3300053139 Bacteria 1665
149 Ga0500603_143293 3300053150 Unclassified 737
150 Ga0500622_0045244 3300053156 Unclassified 2279
151 Ga0500622_0161237 3300053156 Bacteria 1051
152 Ga0500639_281789 3300053163 Unclassified 640
153 Ga0500636_0036132 3300053177 Bacteria 2924
154 Ga0501082_0878966 3300060353 Archaea 784
155 2738727692 2738541278 Bacteria 9755573
156 rootH1_10103761
157 rootH1_10268921
158 Ga0068869_100233921
159 Ga0070673_100693902
160 Ga0070681_10727075
161 Ga0068853_100137905
162 Ga0068853_100416424
163 Ga0068853_101665544
164 Ga0070665_100000074
165 Ga0068855_100043678
166 Ga0068855_100336756
167 Ga0068857_100003092
168 Ga0068857_100344354
169 Ga0068854_100033104
170 Ga0068854_100391743
171 Ga0068856_100033327
172 Ga0068856_100267809
173 Ga0068856_100553852
174 Ga0068852_100011987
175 Ga0068852_100480049
176 Ga0068859_100911516
177 Ga0068863_100799222
178 Ga0068860_100727619
179 Ga0075366_10014291
180 Ga0097620_100911271
181 Ga0105240_10000753
182 Ga0105240_10102112
183 Ga0114129_10022293
184 Ga0105241_10001459
185 Ga0105241_10060274
186 Ga0105237_10031297
187 Ga0105237_10033454
188 Ga0105237_10047698
189 Ga0105237_10469064
190 Ga0105238_10028084
191 Ga0105238_10648011
192 Ga0105239_10009758
193 Ga0105239_11190947
194 Ga0157370_10014717
195 Ga0157369_10010536
196 Ga0163162_10005006
197 Ga0157372_10017386
198 Ga0157372_10047287
199 Ga0213876_10362573
200 Ga0209646_1001253
201 Ga0207647_10024479
202 Ga0207654_10100795
203 Ga0207707_10875433
204 Ga0207695_10000982
205 Ga0207695_10121488
206 Ga0207695_10160378
207 Ga0207671_10003756
208 Ga0207671_10008024
209 Ga0207671_10026486
210 Ga0207671_10041017
211 Ga0207671_10259905
212 Ga0207694_10038358
213 Ga0207694_10063398
214 Ga0207667_10004842
215 Ga0207667_10145511
216 Ga0207640_10024860
217 Ga0207639_10398832
218 Ga0207702_10057121
219 Ga0207702_10211039
220 Ga0207702_10404234
221 Ga0207674_10009764
222 Ga0207674_10035428
223 Ga0207698_10001649
224 Ga0207698_10312245
225 Ga0268266_10000010
226 Ga0268265_10468655
227 Ga0268265_10804128
228 Ga0268264_10000052
229 Ga0265338_10503718
230 Ga0265332_10211314
231 Ga0265339_10000061
232 Ga0265316_10000396
233 Ga0307513_10230671
234 Ga0307513_10508829
235 Ga0307509_10061028
236 Ga0307509_10100951
237 Ga0307514_10350742
238 Ga0265314_10000011
239 Ga0316576_10088853
240 Ga0316576_10402800
241 Ga0373925_0519944
242 Ga0395905_0029460
243 Ga0436365_0210074
244 Ga0439465_0004677
245 Ga0451807_1515299
246 Ga0451833_0211006
247 Ga0451849_1557616
248 Ga0451855_0592141
249 Ga0451853_3150520
250 Ga0439449_0025338
251 Ga0439457_004854
252 Ga0466969_0132834
253 Ga0466972_0000023
254 Ga0466972_0006531
255 Ga0466977_0006959
256 Ga0466966_0000028
257 Ga0466961_0122879
258 Ga0466961_0124648
259 Ga0466964_0077786
260 Ga0453684_0089865
261 Ga0453684_1102454
262 Ga0466957_0000082
263 Ga0466957_0009504
264 Ga0466959_0000047
265 Ga0451576_0047199
266 Ga0495648_0106988
267 Ga0495611_0000135
268 Ga0495687_000039
269 Ga0501032_0113583
270 Ga0501032_0228586
271 Ga0501033_0509675
272 Ga0501036_0605115
273 Ga0501039_0014824
274 Ga0501042_0403508
275 Ga0501043_0271011
276 Ga0501046_0035539
277 Ga0501047_0040550
278 Ga0501047_0196641
279 Ga0501047_0936109
280 Ga0501071_0156842
281 Ga0501198_042253
282 Ga0501230_117944
283 Ga0501225_0005483
284 Ga0501080_0137566
285 Ga0501083_0344559
286 Ga0501035_0130431
287 Ga0501044_0009279
288 nmdc:mga0k408_92466_c1
289 nmdc:mga05p37_16038_c1
290 Ga0500578_0000027
291 Ga0500578_0071267
292 Ga0500578_0431043
293 Ga0500578_0539829
294 Ga0500646_0014922
295 Ga0500646_0103075
296 Ga0500583_0000080
297 Ga0500583_0001678
298 Ga0500651_0434679
299 Ga0500650_0052819
300 Ga0500594_0209081
301 Ga0500642_0024435
302 Ga0500652_013585
303 Ga0500568_0049144
304 Ga0500603_143293
305 Ga0500622_0045244
306 Ga0500622_0161237
307 Ga0500639_281789
308 Ga0500636_0036132
309 Ga0501082_0878966
310 2738727692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06172

Cupin_5

Cupin superfamily (DUF985)

27

167

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3loi-assembly1.cif.gz_A crystal structures of cupin superfamily bbduf985 from branchiostoma belcheri tsingtauense in the apo and gdp-bound forms 0.9412 27 189
1yud-assembly5.cif.gz_I x-ray crystal structure of protein so0799 from shewanella oneidensis. northeast structural genomics consortium target sor12. 0.9387 25 190
1znp-assembly3.cif.gz_F-2 x-ray crystal structure of protein q8u9w0 from agrobacterium tumefaciens. northeast structural genomics consortium target atr55. 0.931 25 168
1yud-assembly5.cif.gz_I x-ray crystal structure of protein so0799 from shewanella oneidensis. northeast structural genomics consortium target sor12. 0.9214 25 190
3loi-assembly1.cif.gz_A crystal structures of cupin superfamily bbduf985 from branchiostoma belcheri tsingtauense in the apo and gdp-bound forms 0.9187 27 189
ID Description Score Start End Superfamily
3loiA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9418 27 188 2.60.120.10
af_Q8GYZ3_2_189_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9326 22 187 2.60.120.10
1znpB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9289 25 167 2.60.120.10
1yudF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9204 25 188 2.60.120.10
3loiA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9191 27 188 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3B7MHK2-F1-model_v4 Cupin domain-containing protein 0.9961 24 188
AF-A0A7J5TS17-F1-model_v4 DUF985 domain-containing protein 0.9942 25 188
AF-A0A3D8Y8Y9-F1-model_v4 DUF985 domain-containing protein 0.9923 25 188
AF-A0A351BY70-F1-model_v4 DUF985 domain-containing protein 0.9897 23 187
AF-A0A3M8F0H4-F1-model_v4 DUF1653 domain-containing protein 0.9896 29 190

Map