F220900

General Info

Members Datasets Scaffolds Average Seq Length
154 133 308 282

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2784746763|2785344708
Length 349
Sequence RREAAGAGTPRMVADVSYVGPDFEPPQPRRSPLRRPLTVAVAAVVVGSVAGWGVWQAVGDPGGGDDGANRAAARNQPRTAPPASPTPSTEPTASEDGSGKDGKDGKKGDDGKKASPTASAGAAADGPLKGKVVVIDPGHNSGNFRHTAEINRKVNIGTAMKECDTTGTSTNDGYTEAEFTLDVSRRVRALLEQQGATVKFTQDGNREWGPCIDERARIGNAAEADAVVSIHADGSAAGNRGFHVILPGSVHEGAADTRPIVGPSRDLGERIAGKFVRETGSAPSNYVGGGTGLVTRQDLGGLNLSTVPKVFIECGNMRDSKDAALLTTGTWRQKAAQGISEGIVSFLRG

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
3 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
4 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
5 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
6 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
7 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
8 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
9 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
10 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
11 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
12 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
13 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
14 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
15 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
16 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
17 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
18 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
19 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
20 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
21 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
22 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
23 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
24 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
25 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
26 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
27 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
28 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
29 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
30 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
31 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
32 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
33 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
34 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
35 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
36 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
37 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
38 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
39 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
40 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
41 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
42 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
43 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
44 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
45 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
46 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
47 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
48 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
49 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
50 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
51 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
52 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
53 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
54 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
55 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
56 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
57 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
58 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
59 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
60 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
61 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
62 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
63 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
64 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
65 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
66 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
67 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
68 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
69 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
80 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
81 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
82 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
83 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
84 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
85 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
86 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
87 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
88 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
89 2643221548 Streptomyces sp. Root55 Isolate Unclassified
90 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
91 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
92 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
93 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
94 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
95 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
96 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
97 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
98 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
99 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
100 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
101 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
102 2867428634 Streptomyces sp. RP5T Isolate Unclassified
103 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
104 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
105 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
106 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
107 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
108 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
109 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
110 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
111 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
112 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
113 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
114 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
115 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
116 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
117 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
118 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
119 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
120 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
121 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
122 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
123 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
124 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
125 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
126 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
127 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
128 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
129 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
130 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
131 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
132 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
133 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 68.83
Metatranscriptomes 0
Isolates 31.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.95
Nodule 0.65
Rhizoplane 1.3
Rhizosphere 75.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10002282 3300011119 Bacteria 11560
2 Ga0182008_10001748 3300014497 Bacteria 14267
3 Ga0182006_1018885 3300015261 Bacteria 2908
4 Ga0182007_10002747 3300015262 Bacteria 8601
5 Ga0207647_10031987 3300025904 Bacteria 3383
6 Ga0207694_10264376 3300025924 Bacteria 1410
7 Ga0207709_10358799 3300025935 Bacteria 1103
8 Ga0207640_10155968 3300025981 Bacteria 1683
9 Ga0307517_10012808 3300028786 Bacteria 11463
10 Ga0307515_10000140 3300028794 Bacteria 172330
11 Ga0307511_10001791 3300030521 Bacteria 22601
12 Ga0307513_10011545 3300031456 Bacteria 10971
13 Ga0307509_10011190 3300031507 Bacteria 10909
14 Ga0307509_10019436 3300031507 Bacteria 7746
15 Ga0307509_10054382 3300031507 Bacteria 4263
16 Ga0307516_10007958 3300031730 Bacteria 12065
17 Ga0307507_10014465 3300033179 Bacteria 9404
18 Ga0307507_10029243 3300033179 Bacteria 5848
19 Ga0307510_10003641 3300033180 Bacteria 17980
20 Ga0307510_10065255 3300033180 Bacteria 3689
21 Ga0307510_10083123 3300033180 Bacteria 3093
22 Ga0395900_0048593 3300037418 Bacteria 4371
23 Ga0395900_0328058 3300037418 Bacteria 1509
24 Ga0395898_0031198 3300037466 Bacteria 5327
25 Ga0395898_0244871 3300037466 Bacteria 1710
26 Ga0395905_0131801 3300037471 Bacteria 2351
27 Ga0439448_0053667 3300042005 Bacteria 1323
28 Ga0439449_0000084 3300042007 Bacteria 30447
29 Ga0439457_000799 3300042014 Bacteria 9388
30 Ga0466969_0036999 3300044656 Bacteria 2463
31 Ga0466972_0036739 3300044658 Bacteria 2395
32 Ga0466972_0048696 3300044658 Bacteria 2047
33 Ga0466965_0003738 3300044683 Bacteria 6716
34 Ga0466966_0002500 3300044684 Bacteria 12047
35 Ga0466961_0001844 3300044693 Bacteria 13160
36 Ga0466961_0116627 3300044693 Bacteria 1678
37 Ga0466963_0000106 3300044694 Bacteria 30236
38 Ga0466971_0000222 3300044719 Bacteria 21742
39 Ga0466970_0001591 3300044765 Bacteria 10938
40 Ga0466970_0002127 3300044765 Bacteria 9568
41 Ga0466957_0024869 3300044842 Bacteria 3547
42 Ga0466960_0216308 3300044901 Bacteria 1053
43 Ga0466958_0000267 3300045836 Bacteria 20182
44 Ga0466967_0022725 3300045976 Bacteria 5125
45 Ga0466967_0031953 3300045976 Bacteria 4439
46 Ga0495629_0006521 3300046459 Bacteria 8647
47 Ga0495629_0044103 3300046459 Bacteria 3130
48 Ga0495651_0002933 3300046462 Bacteria 13194
49 Ga0495653_0099064 3300046463 Bacteria 2116
50 Ga0495662_0000441 3300046476 Bacteria 18666
51 Ga0495664_0009999 3300046477 Bacteria 5322
52 Ga0495583_0026893 3300046506 Bacteria 2846
53 Ga0495628_0152326 3300046516 Bacteria 1760
54 Ga0495652_0040719 3300046529 Bacteria 4016
55 Ga0495640_0059159 3300046533 Bacteria 2611
56 Ga0495586_0009680 3300046535 Bacteria 5132
57 Ga0495587_0001775 3300046536 Bacteria 14425
58 Ga0495645_0121400 3300046543 Bacteria 1839
59 Ga0495667_0022929 3300046559 Bacteria 4207
60 Ga0495634_0003766 3300046642 Bacteria 12059
61 Ga0495625_0120203 3300046660 Bacteria 1788
62 Ga0495635_0003573 3300046663 Bacteria 10759
63 Ga0495657_0011739 3300046675 Bacteria 6533
64 Ga0495623_0070926 3300046679 Bacteria 2169
65 Ga0495646_0000627 3300046680 Bacteria 19270
66 Ga0495613_0000544 3300046689 Bacteria 31241
67 Ga0495671_0020880 3300046692 Bacteria 3447
68 Ga0495649_0045710 3300046694 Bacteria 2386
69 Ga0495589_0042785 3300046794 Bacteria 2256
70 Ga0495600_0006677 3300046809 Bacteria 7031
71 Ga0495581_0008033 3300047315 Bacteria 6111
72 Ga0495604_0003329 3300047317 Bacteria 12808
73 Ga0495604_0065481 3300047317 Bacteria 2766
74 Ga0495636_0001991 3300047318 Bacteria 7822
75 Ga0495676_0009978 3300047321 Bacteria 8628
76 Ga0495676_0139921 3300047321 Bacteria 1735
77 Ga0495676_0155402 3300047321 Bacteria 1623
78 Ga0495687_003155 3300047443 Bacteria 12276
79 Ga0495687_068161 3300047443 Bacteria 1437
80 Ga0495675_0061771 3300047444 Bacteria 2373
81 Ga0495685_003223 3300047447 Bacteria 5184
82 Ga0495681_0005229 3300047470 Bacteria 8719
83 Ga0495686_0220824 3300047472 Bacteria 1078
84 Ga0495602_0027381 3300048088 Bacteria 5477
85 Ga0495614_0005465 3300048089 Bacteria 5728
86 Ga0495614_0007458 3300048089 Bacteria 4870
87 Ga0495614_0025809 3300048089 Bacteria 2534
88 Ga0496108_0157013 3300048911 Bacteria 1965
89 Ga0496109_0396031 3300048912 Bacteria 1305
90 Ga0501033_0007739 3300049570 Bacteria 8333
91 Ga0501033_0072471 3300049570 Bacteria 2529
92 Ga0501034_0001296 3300049571 Bacteria 33823
93 Ga0501034_0169756 3300049571 Bacteria 2149
94 Ga0501036_0000081 3300049572 Bacteria 58719
95 Ga0501038_0161146 3300049574 Bacteria 1823
96 Ga0501039_0016399 3300049575 Bacteria 5675
97 Ga0501043_0000675 3300049579 Bacteria 30027
98 Ga0501047_0017545 3300049581 Bacteria 6858
99 Ga0501070_0000218 3300049586 Bacteria 54494
100 Ga0501074_0064316 3300049590 Bacteria 2641
101 Ga0501035_0088030 3300049822 Bacteria 2736
102 Ga0500572_015942 3300053111 Bacteria 1904
103 Ga0500573_0189130 3300053140 Bacteria 1101
104 Ga0500634_0190552 3300053161 Bacteria 912
105 Ga0466962_0000140 3300061719 Bacteria 29637
106 Ga0466962_0008603 3300061719 Bacteria 4892
107 2785344708 2784746763 Bacteria 9783172
108 2547407735 2547132111 Bacteria 8013147
109 2585313304 2582581314 Bacteria 11452267
110 2643759507 2643221548 Bacteria 8053412
111 2644019004 2643221601 Bacteria 7493239
112 2644180137 2643221631 Bacteria 8168043
113 2644463077 2643221682 Bacteria 6743283
114 2785368201 2784746768 Bacteria 10036182
115 2808919434 2808606375 Bacteria 9466072
116 2812359358 2811994879 Bacteria 9313447
117 2812481491 2811994917 Bacteria 7761064
118 2852640707 2852635781 Bacteria 8251373
119 2862288470 2862281513 Bacteria 9621493
120 2862295808 2862290372 Bacteria 7471434
121 2862392471 2862382967 Bacteria 10317375
122 2863405962 2863404153 Bacteria 9672205
123 2867432691 2867428634 Bacteria 9590268
124 2877682380 2877676314 Bacteria 9512378
125 2912725290 2912723979 Bacteria 8557534
126 2912759704 2912757875 Bacteria 7940295
127 2919468335 2919468124 Bacteria 9133025
128 2946066537 2946064051 Bacteria 8957905
129 2946074801 2946072368 Bacteria 8999607
130 2954675662 2954673503 Bacteria 9685905
131 2954688602 2954682443 Bacteria 9862841
132 2954698354 2954691527 Bacteria 10720516
133 2954703879 2954701450 Bacteria 10834262
134 2954717365 2954711539 Bacteria 10867210
135 2954727333 2954721474 Bacteria 10456478
136 2954734459 2954731030 Bacteria 10243860
137 2954746238 2954740390 Bacteria 10229294
138 2954753356 2954749733 Bacteria 10366972
139 2954765351 2954759201 Bacteria 9358192
140 2966603546 2966598605 Bacteria 7676064
141 2990060505 2990059506 Bacteria 9321252
142 2997456215 2997451912 Bacteria 8492419
143 2997602370 2997600082 Bacteria 9896405
144 3006393990 3006393351 Bacteria 6615579
145 3006427551 3006425503 Bacteria 6491253
146 3006488996 3006486233 Bacteria 8157040
147 3006501337 3006493962 Bacteria 8825450
148 8008579882 8008574985 Bacteria 7815457
149 8023627411 8023623736 Bacteria 8593882
150 8025416157 8025413630 Bacteria 7014048
151 8048413417 8048406513 Bacteria 8936924
152 8056450579 8056447290 Bacteria 7680491
153 8056672965 8056667051 Bacteria 6953971
154 8056836639 8056829672 Bacteria 9045328
155 Ga0105246_10002282
156 Ga0182008_10001748
157 Ga0182006_1018885
158 Ga0182007_10002747
159 Ga0207647_10031987
160 Ga0207694_10264376
161 Ga0207709_10358799
162 Ga0207640_10155968
163 Ga0307517_10012808
164 Ga0307515_10000140
165 Ga0307511_10001791
166 Ga0307513_10011545
167 Ga0307509_10011190
168 Ga0307509_10019436
169 Ga0307509_10054382
170 Ga0307516_10007958
171 Ga0307507_10014465
172 Ga0307507_10029243
173 Ga0307510_10003641
174 Ga0307510_10065255
175 Ga0307510_10083123
176 Ga0395900_0048593
177 Ga0395900_0328058
178 Ga0395898_0031198
179 Ga0395898_0244871
180 Ga0395905_0131801
181 Ga0439448_0053667
182 Ga0439449_0000084
183 Ga0439457_000799
184 Ga0466969_0036999
185 Ga0466972_0036739
186 Ga0466972_0048696
187 Ga0466965_0003738
188 Ga0466966_0002500
189 Ga0466961_0001844
190 Ga0466961_0116627
191 Ga0466963_0000106
192 Ga0466971_0000222
193 Ga0466970_0001591
194 Ga0466970_0002127
195 Ga0466957_0024869
196 Ga0466960_0216308
197 Ga0466958_0000267
198 Ga0466967_0022725
199 Ga0466967_0031953
200 Ga0495629_0006521
201 Ga0495629_0044103
202 Ga0495651_0002933
203 Ga0495653_0099064
204 Ga0495662_0000441
205 Ga0495664_0009999
206 Ga0495583_0026893
207 Ga0495628_0152326
208 Ga0495652_0040719
209 Ga0495640_0059159
210 Ga0495586_0009680
211 Ga0495587_0001775
212 Ga0495645_0121400
213 Ga0495667_0022929
214 Ga0495634_0003766
215 Ga0495625_0120203
216 Ga0495635_0003573
217 Ga0495657_0011739
218 Ga0495623_0070926
219 Ga0495646_0000627
220 Ga0495613_0000544
221 Ga0495671_0020880
222 Ga0495649_0045710
223 Ga0495589_0042785
224 Ga0495600_0006677
225 Ga0495581_0008033
226 Ga0495604_0003329
227 Ga0495604_0065481
228 Ga0495636_0001991
229 Ga0495676_0009978
230 Ga0495676_0139921
231 Ga0495676_0155402
232 Ga0495687_003155
233 Ga0495687_068161
234 Ga0495675_0061771
235 Ga0495685_003223
236 Ga0495681_0005229
237 Ga0495686_0220824
238 Ga0495602_0027381
239 Ga0495614_0005465
240 Ga0495614_0007458
241 Ga0495614_0025809
242 Ga0496108_0157013
243 Ga0496109_0396031
244 Ga0501033_0007739
245 Ga0501033_0072471
246 Ga0501034_0001296
247 Ga0501034_0169756
248 Ga0501036_0000081
249 Ga0501038_0161146
250 Ga0501039_0016399
251 Ga0501043_0000675
252 Ga0501047_0017545
253 Ga0501070_0000218
254 Ga0501074_0064316
255 Ga0501035_0088030
256 Ga0500572_015942
257 Ga0500573_0189130
258 Ga0500634_0190552
259 Ga0466962_0000140
260 Ga0466962_0008603
261 2785344708
262 2547407735
263 2585313304
264 2643759507
265 2644019004
266 2644180137
267 2644463077
268 2785368201
269 2808919434
270 2812359358
271 2812481491
272 2852640707
273 2862288470
274 2862295808
275 2862392471
276 2863405962
277 2867432691
278 2877682380
279 2912725290
280 2912759704
281 2919468335
282 2946066537
283 2946074801
284 2954675662
285 2954688602
286 2954698354
287 2954703879
288 2954717365
289 2954727333
290 2954734459
291 2954746238
292 2954753356
293 2954765351
294 2966603546
295 2990060505
296 2997456215
297 2997602370
298 3006393990
299 3006427551
300 3006488996
301 3006501337
302 8008579882
303 8023627411
304 8025416157
305 8048413417
306 8056450579
307 8056672965
308 8056836639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01520

Amidase_3

N-acetylmuramoyl-L-alanine amidase

133

345

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m6i-assembly1.cif.gz_A structure of the reduced, zn-bound form of mycobacterium tuberculosis peptidoglycan amidase rv3717 0.9512 56 279
4lq6-assembly1.cif.gz_A crystal structure of rv3717 reveals a novel amidase from m. tuberculosis 0.9501 58 278
4m6i-assembly2.cif.gz_B structure of the reduced, zn-bound form of mycobacterium tuberculosis peptidoglycan amidase rv3717 0.948 57 279
4m6i-assembly1.cif.gz_A structure of the reduced, zn-bound form of mycobacterium tuberculosis peptidoglycan amidase rv3717 0.9462 56 279
4lq6-assembly1.cif.gz_A crystal structure of rv3717 reveals a novel amidase from m. tuberculosis 0.9372 58 278
ID Description Score Start End Superfamily
4m6iB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.948 57 279 3.40.630.40
4m6gA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.9442 56 279 3.40.630.40
4m6gA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.9399 56 279 3.40.630.40
4m6iB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.9322 57 279 3.40.630.40
1jwqA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.8918 59 277 3.40.630.40
ID Description Score Start End GO Terms
AF-A0A6B3I6L0-F1-model_v4 N-acetylmuramoyl-L-alanine amidase 1 147 270 GO:0008745
GO:0009253
GO:0030288
AF-A0A7J0CPA2-F1-model_v4 MurNAc-LAA domain-containing protein 0.9948 62 277 GO:0008745
GO:0009253
GO:0030288
AF-A0A5B8JK07-F1-model_v4 N-acetylmuramoyl-L-alanine amidase 0.9917 62 276 GO:0008745
GO:0009253
GO:0030288
AF-A0A061A4L8-F1-model_v4 Cell wall hydrolase/autolysin 0.9887 62 277 GO:0008745
GO:0009253
GO:0030288
AF-B4VGU0-F1-model_v4 deleted 0.9882 130 277

Map