F220679

General Info

Members Datasets Scaffolds Average Seq Length
154 94 308 223

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0014357|Ga0501068_0014357_2597_3382
Length 255
Sequence VTAPAEVRRRRAVVGVLGLAAVALAVAWAIRRIDHLSLDTQATNPLVRWEWVFKRPQTRHELWAATVQHLQLTLLAVGIGIVISALLSAVALRLRWTFTPITTFTGFLYTIPSVALFGLLATRFGNTASAEVALVSYTLLVLVRNMVAGIDGVPRAAVDAADGLGMPRLRRLVTVEVPLALPVIVAGIRVATVTTSAIIQLGGLGVFIFDGYATQFTTKVIVGSVLSIALAVALDAGFHVVEAALTPWTRRGQAS

Samples

Sample ID Description Type Environment
1 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
2 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
24 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
25 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
34 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
35 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
36 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
37 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
38 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
39 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
40 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
41 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
42 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
43 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
44 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
45 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
46 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
47 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
48 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
49 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
50 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
51 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
52 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
53 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
54 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
55 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
56 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
57 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
68 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
69 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
70 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
71 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
72 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
73 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
74 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
75 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
76 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
77 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
78 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
81 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
82 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
83 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
86 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
87 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
88 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
89 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
90 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
91 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
92 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
93 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
94 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 0
Rhizoplane 2.6
Rhizosphere 87.01
Stem 0
Stem Tuber 0
Unclassified 3.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501068_0014357 3300049584 Bacteria 4526
2 Ga0070703_10005634 3300005406 Bacteria 3506
3 Ga0070714_100008262 3300005435 Bacteria 8117
4 Ga0070708_100004332 3300005445 Bacteria 11147
5 Ga0070708_100020380 3300005445 Bacteria 5591
6 Ga0070708_100070208 3300005445 Bacteria 3151
7 Ga0070708_100349235 3300005445 Bacteria 1394
8 Ga0070706_100000008 3300005467 Bacteria 225667
9 Ga0070706_100001044 3300005467 Bacteria 30033
10 Ga0070706_100035838 3300005467 Bacteria 4581
11 Ga0070706_100068798 3300005467 Bacteria 3274
12 Ga0070707_100003161 3300005468 Bacteria 15584
13 Ga0070707_100045392 3300005468 Bacteria 4206
14 Ga0070707_100388147 3300005468 Bacteria 1356
15 Ga0070698_100000591 3300005471 Bacteria 38984
16 Ga0070698_100001234 3300005471 Bacteria 28463
17 Ga0070698_100004653 3300005471 Bacteria 15088
18 Ga0070698_100010976 3300005471 Bacteria 9638
19 Ga0070698_100015499 3300005471 Bacteria 8051
20 Ga0070699_100014192 3300005518 Bacteria 6854
21 Ga0070699_100099772 3300005518 Bacteria 2545
22 Ga0070699_100741279 3300005518 Bacteria 898
23 Ga0070697_100042920 3300005536 Bacteria 3660
24 Ga0070697_100192511 3300005536 Bacteria 1731
25 Ga0070697_100197182 3300005536 Bacteria 1710
26 Ga0070695_100165706 3300005545 Bacteria 1555
27 Ga0081455_10062609 3300005937 Bacteria 3126
28 Ga0081455_10088189 3300005937 Bacteria 2522
29 Ga0081538_10084867 3300005981 Bacteria 1666
30 Ga0070717_10568654 3300006028 Bacteria 1027
31 Ga0075365_10081238 3300006038 Bacteria 2196
32 Ga0075365_10141369 3300006038 Bacteria 1671
33 Ga0075365_10365973 3300006038 Bacteria 1017
34 Ga0075365_10426771 3300006038 Unclassified 936
35 Ga0075363_100187429 3300006048 Bacteria 1179
36 Ga0075364_10155343 3300006051 Bacteria 1543
37 Ga0075364_10241104 3300006051 Bacteria 1228
38 Ga0070716_100073788 3300006173 Bacteria 2014
39 Ga0075367_10007606 3300006178 Bacteria 5562
40 Ga0075428_100000050 3300006844 Bacteria 93539
41 Ga0075428_100272108 3300006844 Bacteria 1822
42 Ga0075428_100566314 3300006844 Unclassified 1214
43 Ga0075429_100747564 3300006880 Bacteria 857
44 Ga0105245_10000601 3300009098 Bacteria 32646
45 Ga0114129_10790055 3300009147 Bacteria 1212
46 Ga0114129_11057568 3300009147 Bacteria 1019
47 Ga0114129_11152195 3300009147 Unclassified 968
48 Ga0105030_102215 3300009987 Unclassified 1700
49 Ga0105028_113927 3300009993 Bacteria 852
50 Ga0099796_10094813 3300010159 Bacteria 1114
51 Ga0105239_11145204 3300010375 Bacteria 896
52 Ga0163162_11265594 3300013306 Bacteria 838
53 Ga0207653_10006014 3300025885 Bacteria 3784
54 Ga0207684_10000007 3300025910 Bacteria 612969
55 Ga0207684_10000029 3300025910 Bacteria 305483
56 Ga0207684_10017066 3300025910 Bacteria 6234
57 Ga0207684_10017262 3300025910 Bacteria 6192
58 Ga0207684_10060673 3300025910 Bacteria 3212
59 Ga0207684_10120027 3300025910 Bacteria 2254
60 Ga0207684_10590390 3300025910 Bacteria 949
61 Ga0207646_10000291 3300025922 Bacteria 68402
62 Ga0207646_10002510 3300025922 Bacteria 21671
63 Ga0207646_10002898 3300025922 Bacteria 19916
64 Ga0207646_10216147 3300025922 Bacteria 1731
65 Ga0207646_10481030 3300025922 Bacteria 1119
66 Ga0207687_10010415 3300025927 Bacteria 6075
67 Ga0207664_10013088 3300025929 Bacteria 5947
68 Ga0316575_10199756 3300031665 Bacteria 832
69 Ga0316576_10066445 3300031727 Bacteria 2652
70 Ga0316578_10076207 3300031728 Bacteria 1991
71 Ga0316577_10068007 3300031733 Bacteria 1989
72 Ga0307413_10076163 3300031824 Bacteria 2132
73 Ga0307410_10063128 3300031852 Bacteria 2540
74 Ga0307410_10159888 3300031852 Bacteria 1687
75 Ga0307407_10124854 3300031903 Bacteria 1638
76 Ga0307409_100032658 3300031995 Bacteria 3777
77 Ga0307409_100492878 3300031995 Bacteria 1191
78 Ga0307416_100089840 3300032002 Bacteria 2632
79 Ga0307416_100148390 3300032002 Bacteria 2146
80 Ga0307416_100366871 3300032002 Bacteria 1464
81 Ga0307411_10126776 3300032005 Bacteria 1858
82 Ga0307415_100449458 3300032126 Bacteria 1114
83 Ga0316574_0307488 3300035398 Bacteria 1008
84 Ga0316574_0337881 3300035398 Bacteria 954
85 Ga0373937_0245916 3300036401 Bacteria 1686
86 Ga0316582_0005035 3300036647 Bacteria 6757
87 Ga0316584_0028368 3300036712 Bacteria 4127
88 Ga0400485_01246 3300038735 Bacteria 1192
89 Ga0400485_05346 3300038735 Bacteria 3265
90 Ga0450910_010141 3300042147 Bacteria 1339
91 Ga0466966_0036067 3300044684 Bacteria 3194
92 Ga0466959_0072177 3300045049 Bacteria 2499
93 Ga0495613_0541954 3300046689 Bacteria 779
94 Ga0496104_0306800 3300048907 Bacteria 1500
95 Ga0496108_0147286 3300048911 Bacteria 2030
96 Ga0496110_0111792 3300048913 Bacteria 2456
97 Ga0496114_0349489 3300048917 Bacteria 1308
98 Ga0501031_0006450 3300049568 Bacteria 7649
99 Ga0501032_0082094 3300049569 Bacteria 2144
100 Ga0501033_0005140 3300049570 Bacteria 10403
101 Ga0501036_0271061 3300049572 Bacteria 1421
102 Ga0501037_0010310 3300049573 Bacteria 6855
103 Ga0501038_0158295 3300049574 Bacteria 1842
104 Ga0501038_0397284 3300049574 Bacteria 1067
105 Ga0501041_0009996 3300049577 Bacteria 5590
106 Ga0501042_0061609 3300049578 Bacteria 2680
107 Ga0501043_0093165 3300049579 Bacteria 2368
108 Ga0501046_0081707 3300049580 Bacteria 2495
109 Ga0501068_0223998 3300049584 Bacteria 1195
110 Ga0501068_0280121 3300049584 Bacteria 1065
111 Ga0501069_0001427 3300049585 Bacteria 11718
112 Ga0501069_0052682 3300049585 Bacteria 2266
113 Ga0501070_0003228 3300049586 Bacteria 14184
114 Ga0501070_0003871 3300049586 Bacteria 12909
115 Ga0501072_0353447 3300049588 Bacteria 1166
116 Ga0501073_0000079 3300049589 Bacteria 60586
117 Ga0501073_0005352 3300049589 Bacteria 9623
118 Ga0501073_0242773 3300049589 Bacteria 1244
119 Ga0501074_0191173 3300049590 Bacteria 1459
120 Ga0501077_0130775 3300049593 Bacteria 1591
121 Ga0501208_045576 3300049655 Unclassified 823
122 Ga0501079_0052951 3300049741 Bacteria 3131
123 Ga0501079_0101103 3300049741 Bacteria 2235
124 Ga0501079_0120893 3300049741 Bacteria 2037
125 Ga0501079_0353218 3300049741 Bacteria 1152
126 Ga0501080_0013854 3300049742 Bacteria 7421
127 Ga0501080_0172897 3300049742 Bacteria 1991
128 Ga0501081_0020821 3300049743 Bacteria 4375
129 Ga0501081_0054767 3300049743 Bacteria 2755
130 Ga0501083_0004160 3300049744 Bacteria 10189
131 Ga0501035_0112658 3300049822 Bacteria 2383
132 Ga0501044_0018858 3300049823 Bacteria 7387
133 Ga0501044_0026149 3300049823 Bacteria 6181
134 Ga0501044_0073086 3300049823 Bacteria 3486
135 Ga0501045_0009144 3300049824 Bacteria 6922
136 nmdc:mga03n38_184446_c1 3300050490 Bacteria 1071
137 nmdc:mga0yw44_134400_c1 3300050492 Bacteria 1603
138 nmdc:mga0yw44_142362_c1 3300050492 Bacteria 1559
139 nmdc:mga0yw44_98574_c1 3300050492 Bacteria 1858
140 nmdc:mga06z11_44343_c1 3300050494 Bacteria 2242
141 nmdc:mga05p37_502673_c1 3300050507 Bacteria 1391
142 nmdc:mga05p37_988570_c1 3300050507 Bacteria 895
143 nmdc:mga09592_297080_c1 3300050508 Bacteria 1400
144 nmdc:mga0qj67_306841_c1 3300050509 Bacteria 1286
145 nmdc:mga06r32_114221_c1 3300050510 Bacteria 2658
146 Ga0495601_0290420 3300053077 Bacteria 1066
147 Ga0500566_0060672 3300053094 Bacteria 2141
148 Ga0501084_0000035 3300054114 Bacteria 112926
149 Ga0501084_0409185 3300054114 Bacteria 1146
150 Ga0590071_003845 3300059421 Bacteria 3683
151 Ga0590075_003558 3300059424 Bacteria 3695
152 Ga0590077_025380 3300059426 Bacteria 1276
153 Ga0501082_0117710 3300060353 Bacteria 2302
154 Ga0501082_0148995 3300060353 Bacteria 2032
155 Ga0501068_0014357
156 Ga0070703_10005634
157 Ga0070714_100008262
158 Ga0070708_100004332
159 Ga0070708_100020380
160 Ga0070708_100070208
161 Ga0070708_100349235
162 Ga0070706_100000008
163 Ga0070706_100001044
164 Ga0070706_100035838
165 Ga0070706_100068798
166 Ga0070707_100003161
167 Ga0070707_100045392
168 Ga0070707_100388147
169 Ga0070698_100000591
170 Ga0070698_100001234
171 Ga0070698_100004653
172 Ga0070698_100010976
173 Ga0070698_100015499
174 Ga0070699_100014192
175 Ga0070699_100099772
176 Ga0070699_100741279
177 Ga0070697_100042920
178 Ga0070697_100192511
179 Ga0070697_100197182
180 Ga0070695_100165706
181 Ga0081455_10062609
182 Ga0081455_10088189
183 Ga0081538_10084867
184 Ga0070717_10568654
185 Ga0075365_10081238
186 Ga0075365_10141369
187 Ga0075365_10365973
188 Ga0075365_10426771
189 Ga0075363_100187429
190 Ga0075364_10155343
191 Ga0075364_10241104
192 Ga0070716_100073788
193 Ga0075367_10007606
194 Ga0075428_100000050
195 Ga0075428_100272108
196 Ga0075428_100566314
197 Ga0075429_100747564
198 Ga0105245_10000601
199 Ga0114129_10790055
200 Ga0114129_11057568
201 Ga0114129_11152195
202 Ga0105030_102215
203 Ga0105028_113927
204 Ga0099796_10094813
205 Ga0105239_11145204
206 Ga0163162_11265594
207 Ga0207653_10006014
208 Ga0207684_10000007
209 Ga0207684_10000029
210 Ga0207684_10017066
211 Ga0207684_10017262
212 Ga0207684_10060673
213 Ga0207684_10120027
214 Ga0207684_10590390
215 Ga0207646_10000291
216 Ga0207646_10002510
217 Ga0207646_10002898
218 Ga0207646_10216147
219 Ga0207646_10481030
220 Ga0207687_10010415
221 Ga0207664_10013088
222 Ga0316575_10199756
223 Ga0316576_10066445
224 Ga0316578_10076207
225 Ga0316577_10068007
226 Ga0307413_10076163
227 Ga0307410_10063128
228 Ga0307410_10159888
229 Ga0307407_10124854
230 Ga0307409_100032658
231 Ga0307409_100492878
232 Ga0307416_100089840
233 Ga0307416_100148390
234 Ga0307416_100366871
235 Ga0307411_10126776
236 Ga0307415_100449458
237 Ga0316574_0307488
238 Ga0316574_0337881
239 Ga0373937_0245916
240 Ga0316582_0005035
241 Ga0316584_0028368
242 Ga0400485_01246
243 Ga0400485_05346
244 Ga0450910_010141
245 Ga0466966_0036067
246 Ga0466959_0072177
247 Ga0495613_0541954
248 Ga0496104_0306800
249 Ga0496108_0147286
250 Ga0496110_0111792
251 Ga0496114_0349489
252 Ga0501031_0006450
253 Ga0501032_0082094
254 Ga0501033_0005140
255 Ga0501036_0271061
256 Ga0501037_0010310
257 Ga0501038_0158295
258 Ga0501038_0397284
259 Ga0501041_0009996
260 Ga0501042_0061609
261 Ga0501043_0093165
262 Ga0501046_0081707
263 Ga0501068_0223998
264 Ga0501068_0280121
265 Ga0501069_0001427
266 Ga0501069_0052682
267 Ga0501070_0003228
268 Ga0501070_0003871
269 Ga0501072_0353447
270 Ga0501073_0000079
271 Ga0501073_0005352
272 Ga0501073_0242773
273 Ga0501074_0191173
274 Ga0501077_0130775
275 Ga0501208_045576
276 Ga0501079_0052951
277 Ga0501079_0101103
278 Ga0501079_0120893
279 Ga0501079_0353218
280 Ga0501080_0013854
281 Ga0501080_0172897
282 Ga0501081_0020821
283 Ga0501081_0054767
284 Ga0501083_0004160
285 Ga0501035_0112658
286 Ga0501044_0018858
287 Ga0501044_0026149
288 Ga0501044_0073086
289 Ga0501045_0009144
290 nmdc:mga03n38_184446_c1
291 nmdc:mga0yw44_134400_c1
292 nmdc:mga0yw44_142362_c1
293 nmdc:mga0yw44_98574_c1
294 nmdc:mga06z11_44343_c1
295 nmdc:mga05p37_502673_c1
296 nmdc:mga05p37_988570_c1
297 nmdc:mga09592_297080_c1
298 nmdc:mga0qj67_306841_c1
299 nmdc:mga06r32_114221_c1
300 Ga0495601_0290420
301 Ga0500566_0060672
302 Ga0501084_0000035
303 Ga0501084_0409185
304 Ga0590071_003845
305 Ga0590075_003558
306 Ga0590077_025380
307 Ga0501082_0117710
308 Ga0501082_0148995

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

76

247

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.931 27 203
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.9219 13 207
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.8972 11 203
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.882 24 211
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.8768 20 202
ID Description Score Start End Superfamily
af_P14176_140_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9628 22 208 1.10.3720.10
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9608 20 208 1.10.3720.10
af_O69722_23_210_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9538 21 206 1.10.3720.10
af_O69723_10_204_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9491 26 209 1.10.3720.10
af_Q2FVH1_15_213_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9456 16 212 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A536AFP3-F1-model_v4 ABC transporter permease 0.9956 8 217 GO:0005886
GO:0031460
GO:0055085
AF-A0A7Z6XIU3-F1-model_v4 ABC transporter permease 0.991 23 215 GO:0005886
GO:0031460
GO:0055085
AF-A0A536AFP3-F1-model_v4 ABC transporter permease 0.9909 8 217 GO:0005886
GO:0031460
GO:0055085
AF-A0A1D8G493-F1-model_v4 Carnitine transport permease protein OpuCB 0.9878 6 215 GO:0005886
GO:0031460
GO:0055085
AF-A0A7X6CXL4-F1-model_v4 ABC transporter permease 0.9878 7 215 GO:0005886
GO:0031460
GO:0055085

Map