F220572

General Info

Members Datasets Scaffolds Average Seq Length
154 132 308 287

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0053410|Ga0496116_0053410_1308_2198
Length 296
Sequence MDLLVRLNVALSYIEDNLTHEVDYKEAARIACCSEYHFTRMFSFLSGITLSEYIRRRRLTLAALELSHGESKVIDVALKYGYASPDSFARAFQSVHGVRPSEAKVHGQLLKAFPRMTFQLTVKGGSEMNYRIEDKEAFRIVGIKKRVPIVFQGVNPGIAAMYESLTPELIGALKGLSNVQPSGLINASVNFGEGRMEEKGELDHYIGAATTKEAPEGLEQLEVQASAWAVFQSEGPFPSALQEVWGRIYSEWFPSSDYELSEGPEMLWNESKEVASPQFKSEIWIPVVRKGNGQPG

Samples

Sample ID Description Type Environment
1 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
8 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
9 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
10 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
11 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
13 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
14 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
15 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
16 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
20 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
21 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
22 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
23 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
24 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
25 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
26 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
27 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
28 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
29 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
30 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
31 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
32 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
33 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
34 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
35 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
36 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
37 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
38 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
39 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
40 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
41 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
42 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
43 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
44 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
45 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
46 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
47 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
48 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
49 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
50 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
51 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
52 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
53 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
54 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
55 2643221732 Bacillus sp. Root239 Isolate Unclassified
56 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
57 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
58 2738541358 Bacillus sp. OV752 Isolate Unclassified
59 2738543006 Bacillus sp. OK077 Isolate Unclassified
60 2738543010 Bacillus sp. YR335 Isolate Unclassified
61 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
62 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
63 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
64 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
65 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
66 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
67 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
68 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
69 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
70 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
71 2818991459 Paenibacillus sp. 597 Isolate Unclassified
72 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
73 2842682962 Bacillus sp. R-72492 Isolate Unclassified
74 2842882022 Bacillus sp. R-71893 Isolate Unclassified
75 2849139964 Bacillus sp. R-71875 Isolate Unclassified
76 2857472729 Cohnella sp. R-74144 Isolate Unclassified
77 2857581216 Bacillus sp. R-71922 Isolate Unclassified
78 2860837431 Bacillus sp. WR11 Isolate Unclassified
79 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
80 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
81 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
82 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
83 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
84 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
85 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
86 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
87 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
88 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
89 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
90 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
91 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
92 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
93 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
94 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
95 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
96 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
97 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
98 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
99 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
100 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
101 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
102 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
103 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
104 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
105 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
106 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
107 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
108 2965761152 Bacillus sp. COPE52 Isolate Unclassified
109 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
110 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
111 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
112 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
113 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
114 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
115 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
116 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
117 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
118 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
119 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
120 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
121 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
122 8022653035 Bacillus sp. Rc4 Isolate Unclassified
123 8022792930 Bacillus sp. Xin Isolate Rhizosphere
124 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
125 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
126 8023438354 Bacillus sp. BH2 Isolate Unclassified
127 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
128 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
129 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
130 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
131 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
132 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 39.61
Metatranscriptomes 0.65
Isolates 59.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.74
Nodule 1.3
Rhizoplane 12.34
Rhizosphere 35.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496116_0053410 3300048919 Bacteria 2668
2 JGI25151J46595_10001336 3300003187 Bacteria 17186
3 JGI25151J46595_10003515 3300003187 Bacteria 8625
4 rootH1_10016905 3300003316 Bacteria 5025
5 rootH1_10054819 3300003316 Bacteria 5132
6 rootL2_10305272 3300003322 Bacteria 2307
7 Ga0006562J51391_1007365 3300003578 Bacteria 2040
8 Ga0055528_1029206 3300003790 Bacteria 1499
9 Ga0105244_10080334 3300009036 Bacteria 1615
10 Ga0105244_10188011 3300009036 Bacteria 977
11 Ga0105250_10003387 3300009092 Bacteria 7560
12 Ga0105250_10008226 3300009092 Bacteria 4441
13 Ga0157374_10036738 3300013296 Bacteria 4490
14 Ga0209566_101081 3300025225 Bacteria 10698
15 Ga0209147_100058 3300025229 Bacteria 252750
16 Ga0209147_100131 3300025229 Bacteria 120381
17 Ga0209673_1008140 3300025273 Bacteria 4712
18 Ga0209130_1001363 3300025284 Bacteria 16482
19 Ga0209130_1003894 3300025284 Bacteria 5999
20 Ga0209130_1004977 3300025284 Bacteria 4806
21 Ga0209025_1003979 3300025294 Bacteria 13265
22 Ga0209025_1010061 3300025294 Bacteria 6472
23 Ga0209025_1018819 3300025294 Bacteria 3886
24 Ga0209025_1029207 3300025294 Bacteria 2677
25 Ga0207426_1019947 3300025302 Bacteria 2337
26 Ga0207696_1001308 3300025711 Bacteria 13766
27 Ga0207655_1015597 3300025728 Bacteria 4210
28 Ga0207655_1054858 3300025728 Bacteria 1581
29 Ga0207713_1011213 3300025735 Bacteria 4892
30 Ga0207713_1018679 3300025735 Bacteria 3425
31 Ga0209371_1016348 3300027312 Bacteria 1961
32 Ga0268256_1017111 3300030500 Bacteria 2053
33 Ga0307416_100210804 3300032002 Bacteria 1853
34 Ga0237819_00693 3300038705 Bacteria 10933
35 Ga0495636_0238229 3300047318 Bacteria 839
36 Ga0496100_0001476 3300048903 Bacteria 11508
37 Ga0496101_0003256 3300048904 Bacteria 10088
38 Ga0496102_0022013 3300048905 Bacteria 5646
39 Ga0496102_0042997 3300048905 Bacteria 4095
40 Ga0496103_0054459 3300048906 Bacteria 2479
41 Ga0496104_0004280 3300048907 Bacteria 12410
42 Ga0496105_0062685 3300048908 Bacteria 3068
43 Ga0496106_0007025 3300048909 Bacteria 8314
44 Ga0496107_0012778 3300048910 Bacteria 5866
45 Ga0496108_0016626 3300048911 Bacteria 6008
46 Ga0496109_0020239 3300048912 Bacteria 5876
47 Ga0496110_0142943 3300048913 Bacteria 2163
48 Ga0496110_0233908 3300048913 Bacteria 1671
49 Ga0496111_0001501 3300048914 Bacteria 13368
50 Ga0496111_0088258 3300048914 Bacteria 2271
51 Ga0496112_0014929 3300048915 Bacteria 7228
52 Ga0496113_0158135 3300048916 Bacteria 1790
53 Ga0496116_0027867 3300048919 Bacteria 4104
54 Ga0496116_0157674 3300048919 Bacteria 1250
55 Ga0496119_0019060 3300048922 Bacteria 5073
56 Ga0496119_0024838 3300048922 Bacteria 4202
57 Ga0496122_0009661 3300048925 Bacteria 10095
58 Ga0496124_0000339 3300048927 Bacteria 85830
59 Ga0496124_0073148 3300048927 Bacteria 2837
60 Ga0496125_0000835 3300048928 Bacteria 49574
61 Ga0496125_0013518 3300048928 Bacteria 8021
62 Ga0496126_0026729 3300048929 Bacteria 5527
63 2511700368 2511231119 Bacteria 4019861
64 2512639428 2512564013 Bacteria 6286191
65 2540605612 2540341094 Bacteria 4061186
66 2545557053 2545555800 Bacteria 4222588
67 2573038680 2571042588 Bacteria 5045676
68 2578337763 2576861424 Bacteria 5270569
69 2578931312 2576861599 Bacteria 4217202
70 2580932600 2579778775 Bacteria 5360914
71 2595090811 2593339131 Bacteria 5116855
72 2595319432 2593339198 Bacteria 7267884
73 2601638580 2600255286 Bacteria 5390125
74 2621276104 2619619294 Bacteria 5575484
75 2644722690 2643221732 Bacteria 5756404
76 2672333299 2671180330 Bacteria 5521719
77 2695628361 2695420354 Bacteria 3922431
78 2739157411 2738541358 Bacteria 5932299
79 2739209504 2738543006 Bacteria 5904091
80 2739231047 2738543010 Bacteria 5583595
81 2745166462 2744054657 Bacteria 5016802
82 2757568605 2757320391 Bacteria 4746095
83 2777763597 2775507177 Bacteria 4384303
84 2777835819 2775507192 Bacteria 4622234
85 2791213259 2788500588 Bacteria 4584915
86 2808867382 2808606364 Bacteria 4465927
87 2809055207 2808606399 Bacteria 4021018
88 2816861929 2816332186 Bacteria 5331395
89 2817479135 2816332295 Bacteria 4352468
90 2819625586 2818991451 Bacteria 4697364
91 2819669106 2818991459 Bacteria 8736032
92 2821116293 2821111986 Bacteria 6894338
93 2842686796 2842682962 Bacteria 5589973
94 2842883715 2842882022 Bacteria 6158489
95 2849141743 2849139964 Bacteria 5613304
96 2857478811 2857472729 Bacteria 6568124
97 2857583802 2857581216 Bacteria 5522813
98 2860837998 2860837431 Bacteria 4202080
99 2864734281 2864733723 Bacteria 6770668
100 2865002981 2865002811 Bacteria 6333767
101 2877771255 2877768649 Bacteria 3957164
102 2880172122 2880169592 Bacteria 3900066
103 2889048643 2889042446 Bacteria 7618936
104 2889051575 2889049205 Bacteria 7524325
105 2904118753 2904113452 Bacteria 7796941
106 2904494896 2904490793 Bacteria 7046938
107 2904525256 2904524088 Bacteria 5887454
108 2904562210 2904560550 Bacteria 4029838
109 2904608760 2904606771 Bacteria 4684500
110 2904762186 2904755435 Bacteria 7986759
111 2907207432 2907202186 Bacteria 6632024
112 2915602300 2915597211 Bacteria 6475886
113 2915609259 2915606848 Bacteria 6032732
114 2919146155 2919143609 Bacteria 6219228
115 2919163994 2919160200 Bacteria 6929020
116 2919429268 2919425241 Bacteria 8055701
117 2919518077 2919517244 Bacteria 5858162
118 2928097003 2928093941 Bacteria 5965005
119 2929187480 2929183550 Bacteria 6377511
120 2931385755 2931384279 Bacteria 7299545
121 2936342121 2936340661 Bacteria 5139038
122 2945995635 2945991243 Bacteria 7008369
123 2946058358 2946053406 Bacteria 6978655
124 2956900842 2956897341 Bacteria 5447711
125 2960322969 2960319331 Bacteria 5502575
126 2960381795 2960375949 Bacteria 5361395
127 2962291332 2962290636 Bacteria 4072939
128 2965766057 2965761152 Bacteria 5806513
129 2968559648 2968558590 Bacteria 6956864
130 2969137423 2969136845 Bacteria 3923176
131 2969774791 2969770375 Bacteria 4271280
132 2971512367 2971511577 Bacteria 5404012
133 2980177471 2980176882 Bacteria 5397533
134 2980185418 2980182181 Bacteria 9454109
135 2980493173 2980492589 Bacteria 4072961
136 2988230637 2988225383 Bacteria 7221625
137 2996638409 2996632988 Bacteria 6921523
138 3006830862 3006826541 Bacteria 4678913
139 3006859462 3006858327 Bacteria 4317835
140 3006970491 3006969106 Bacteria 4739423
141 8022631996 8022630665 Bacteria 3886130
142 8022656033 8022653035 Bacteria 4035078
143 8022793243 8022792930 Bacteria 5693794
144 8022896593 8022893055 Bacteria 5300455
145 8022952672 8022948649 Bacteria 5366783
146 8023439237 8023438354 Bacteria 5779374
147 8051955797 8051952484 Bacteria 3926774
148 8054469296 8054465665 Bacteria 7323556
149 8054803606 8054795415 Bacteria 9785225
150 8055634153 8055632911 Bacteria 5283357
151 8055636304 8055632911 Bacteria 5283357
152 8057473839 8057473075 Bacteria 5892720
153 8057476289 8057473075 Bacteria 5892720
154 8057979356 8057977335 Bacteria 5694872
155 Ga0496116_0053410
156 JGI25151J46595_10001336
157 JGI25151J46595_10003515
158 rootH1_10016905
159 rootH1_10054819
160 rootL2_10305272
161 Ga0006562J51391_1007365
162 Ga0055528_1029206
163 Ga0105244_10080334
164 Ga0105244_10188011
165 Ga0105250_10003387
166 Ga0105250_10008226
167 Ga0157374_10036738
168 Ga0209566_101081
169 Ga0209147_100058
170 Ga0209147_100131
171 Ga0209673_1008140
172 Ga0209130_1001363
173 Ga0209130_1003894
174 Ga0209130_1004977
175 Ga0209025_1003979
176 Ga0209025_1010061
177 Ga0209025_1018819
178 Ga0209025_1029207
179 Ga0207426_1019947
180 Ga0207696_1001308
181 Ga0207655_1015597
182 Ga0207655_1054858
183 Ga0207713_1011213
184 Ga0207713_1018679
185 Ga0209371_1016348
186 Ga0268256_1017111
187 Ga0307416_100210804
188 Ga0237819_00693
189 Ga0495636_0238229
190 Ga0496100_0001476
191 Ga0496101_0003256
192 Ga0496102_0022013
193 Ga0496102_0042997
194 Ga0496103_0054459
195 Ga0496104_0004280
196 Ga0496105_0062685
197 Ga0496106_0007025
198 Ga0496107_0012778
199 Ga0496108_0016626
200 Ga0496109_0020239
201 Ga0496110_0142943
202 Ga0496110_0233908
203 Ga0496111_0001501
204 Ga0496111_0088258
205 Ga0496112_0014929
206 Ga0496113_0158135
207 Ga0496116_0027867
208 Ga0496116_0157674
209 Ga0496119_0019060
210 Ga0496119_0024838
211 Ga0496122_0009661
212 Ga0496124_0000339
213 Ga0496124_0073148
214 Ga0496125_0000835
215 Ga0496125_0013518
216 Ga0496126_0026729
217 2511700368
218 2512639428
219 2540605612
220 2545557053
221 2573038680
222 2578337763
223 2578931312
224 2580932600
225 2595090811
226 2595319432
227 2601638580
228 2621276104
229 2644722690
230 2672333299
231 2695628361
232 2739157411
233 2739209504
234 2739231047
235 2745166462
236 2757568605
237 2777763597
238 2777835819
239 2791213259
240 2808867382
241 2809055207
242 2816861929
243 2817479135
244 2819625586
245 2819669106
246 2821116293
247 2842686796
248 2842883715
249 2849141743
250 2857478811
251 2857583802
252 2860837998
253 2864734281
254 2865002981
255 2877771255
256 2880172122
257 2889048643
258 2889051575
259 2904118753
260 2904494896
261 2904525256
262 2904562210
263 2904608760
264 2904762186
265 2907207432
266 2915602300
267 2915609259
268 2919146155
269 2919163994
270 2919429268
271 2919518077
272 2928097003
273 2929187480
274 2931385755
275 2936342121
276 2945995635
277 2946058358
278 2956900842
279 2960322969
280 2960381795
281 2962291332
282 2965766057
283 2968559648
284 2969137423
285 2969774791
286 2971512367
287 2980177471
288 2980185418
289 2980493173
290 2988230637
291 2996638409
292 3006830862
293 3006859462
294 3006970491
295 8022631996
296 8022656033
297 8022793243
298 8022896593
299 8022952672
300 8023439237
301 8051955797
302 8054469296
303 8054803606
304 8055634153
305 8055636304
306 8057473839
307 8057476289
308 8057979356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

27

104

0.98

PF06445

GyrI-like

GyrI-like small molecule binding domain

128

288

0.95

PF14526

Cass2

Integron-associated effector binding protein

131

287

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.9043 5 104
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.8743 6 104
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8638 9 105
3mn2-assembly2.cif.gz_B the crystal structure of a probable arac family transcriptional regulator from rhodopseudomonas palustris cga009 0.8569 1 104
1bl0-assembly1.cif.gz_A multiple antibiotic resistance protein (mara)/dna complex 0.8568 4 107
ID Description Score Start End Superfamily
1bl0A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9612 60 107 1.10.10.60
1xs9A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9573 60 106 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9523 62 105 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9503 58 104 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9192 61 105 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A3D8WTE2-F1-model_v4 AraC family transcriptional regulator 0.9387 5 104 GO:0003700
GO:0043565
AF-A0A519R074-F1-model_v4 AraC family transcriptional regulator 0.934 5 104 GO:0003700
GO:0043565
AF-A0A536L2X9-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9336 3 104 GO:0003700
GO:0043565
AF-A0A7K1YE57-F1-model_v4 Helix-turn-helix domain-containing protein 0.9308 5 104 GO:0003700
GO:0043565
AF-A0A1V2S9E3-F1-model_v4 deleted 0.929 5 104

Map