F220314

General Info

Members Datasets Scaffolds Average Seq Length
154 59 308 242

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0008224|Ga0453684_0008224_5059_5952
Length 274
Sequence MSSFFVRQAGRRGQRGFCYIRYMEAHMDIQRLSAFSPVTLAFFATLFTWAVTALGSGMVFFFKSINRKLLNAMLGFAAGIMIAASFWSLLKPAIEMSEADGGISWLPAVLGFLAGGAVLWGFDRVLPHLHLGLDMSKAEGIKTSWQRSILLVTAITLHNIPEGLAVGVAFGALGQGFTPAALGGRREGFSRRRAFFYGQLSGLVEPVGGILGALLVILVRPILPYALAFAAGAMIFVVVEELIPESQSGQETDMSTIGAMLGFALMMFLDVALG

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
3 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
4 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
5 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
6 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
7 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
8 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
9 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
10 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
11 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
12 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
13 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
14 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
15 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
16 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
17 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
19 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
20 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
21 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
22 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
23 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
24 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
25 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
26 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
27 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
28 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
29 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
30 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
31 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
32 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
33 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
34 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
35 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
36 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
37 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
38 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
39 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
40 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
41 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
42 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
43 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
44 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
45 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
46 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
47 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
48 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
49 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
50 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
51 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
52 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
53 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
54 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
55 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
56 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
57 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
58 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
59 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0.65
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.7
Stem 0
Stem Tuber 0
Unclassified 13.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0008224 3300044712 Bacteria 18810
2 Ga0075430_100069673 3300006846 Bacteria 2950
3 Ga0316575_10001889 3300031665 Bacteria 6910
4 Ga0316575_10015661 3300031665 Bacteria 2860
5 Ga0316575_10030904 3300031665 Bacteria 2095
6 Ga0316579_10051995 3300031691 Bacteria 1918
7 Ga0316579_10108213 3300031691 Bacteria 1333
8 Ga0316579_10160574 3300031691 Bacteria 1086
9 Ga0316576_10007990 3300031727 Bacteria 6706
10 Ga0316576_10011265 3300031727 Bacteria 5851
11 Ga0316576_10039897 3300031727 Bacteria 3372
12 Ga0316576_10041023 3300031727 Bacteria 3329
13 Ga0316576_10043220 3300031727 Bacteria 3250
14 Ga0316576_10081974 3300031727 Bacteria 2394
15 Ga0316576_10102466 3300031727 Bacteria 2141
16 Ga0316576_10119388 3300031727 Bacteria 1979
17 Ga0316576_10126350 3300031727 Bacteria 1922
18 Ga0316578_10007673 3300031728 Bacteria 5433
19 Ga0316578_10030585 3300031728 Bacteria 3062
20 Ga0316578_10173402 3300031728 Bacteria 1300
21 Ga0316578_10274230 3300031728 Bacteria 1010
22 Ga0316577_10008633 3300031733 Bacteria 5465
23 Ga0316577_10010075 3300031733 Bacteria 5095
24 Ga0316577_10026148 3300031733 Bacteria 3249
25 Ga0316577_10083500 3300031733 Bacteria 1787
26 Ga0307413_10165305 3300031824 Bacteria 1559
27 Ga0307410_10009665 3300031852 Bacteria 5423
28 Ga0307410_10131321 3300031852 Bacteria 1840
29 Ga0307410_10168118 3300031852 Bacteria 1649
30 Ga0307406_10227505 3300031901 Bacteria 1390
31 Ga0307407_10038926 3300031903 Bacteria 2640
32 Ga0307409_100090190 3300031995 Bacteria 2508
33 Ga0307414_10079371 3300032004 Bacteria 2396
34 Ga0307411_10187003 3300032005 Bacteria 1577
35 Ga0307411_10259224 3300032005 Bacteria 1372
36 Ga0316583_10002616 3300032133 Bacteria 6283
37 Ga0316585_10006613 3300032137 Bacteria 3317
38 Ga0316596_1041128 3300033541 Bacteria 1215
39 Ga0316574_0006370 3300035398 Bacteria 6377
40 Ga0316574_0019426 3300035398 Bacteria 4008
41 Ga0316574_0071632 3300035398 Bacteria 2189
42 Ga0316574_0095500 3300035398 Bacteria 1900
43 Ga0316574_0130704 3300035398 Bacteria 1615
44 Ga0316574_0146348 3300035398 Bacteria 1523
45 Ga0316574_0165182 3300035398 Bacteria 1425
46 Ga0316582_0000990 3300036647 Bacteria 11844
47 Ga0316582_0010300 3300036647 Bacteria 5113
48 Ga0316582_0025371 3300036647 Bacteria 3558
49 Ga0316582_0029362 3300036647 Bacteria 3340
50 Ga0316582_0030793 3300036647 Bacteria 3273
51 Ga0316582_0038384 3300036647 Bacteria 2976
52 Ga0316582_0054127 3300036647 Bacteria 2553
53 Ga0316584_0005387 3300036712 Bacteria 8583
54 Ga0316584_0009843 3300036712 Bacteria 6655
55 Ga0316584_0023380 3300036712 Bacteria 4515
56 Ga0316584_0043761 3300036712 Unclassified 3339
57 Ga0316584_0297191 3300036712 Bacteria 1170
58 Ga0316581_0001179 3300037588 Bacteria 5738
59 Ga0316581_0001974 3300037588 Bacteria 4806
60 Ga0316581_0078501 3300037588 Bacteria 1015
61 Ga0450910_006359 3300042147 Bacteria 1629
62 Ga0451577_0061490 3300042876 Bacteria 3349
63 Ga0451577_0658053 3300042876 Bacteria 950
64 Ga0453683_0000015 3300044673 Bacteria 346024
65 Ga0453683_0000162 3300044673 Bacteria 97997
66 Ga0453683_0000177 3300044673 Bacteria 88678
67 Ga0453683_0033676 3300044673 Bacteria 3232
68 Ga0453683_0075081 3300044673 Bacteria 2116
69 Ga0453683_0147108 3300044673 Bacteria 1488
70 Ga0453683_0187828 3300044673 Bacteria 1311
71 Ga0453683_0296807 3300044673 Bacteria 1033
72 Ga0453683_0306580 3300044673 Bacteria 1016
73 Ga0453683_0374321 3300044673 Bacteria 916
74 Ga0453684_0000666 3300044712 Bacteria 122914
75 Ga0453684_0007810 3300044712 Bacteria 19511
76 Ga0453684_0009445 3300044712 Bacteria 17060
77 Ga0453684_0017613 3300044712 Bacteria 11048
78 Ga0453684_0024664 3300044712 Bacteria 8773
79 Ga0453684_0033646 3300044712 Bacteria 7140
80 Ga0453684_0034075 3300044712 Bacteria 7079
81 Ga0453684_0046401 3300044712 Bacteria 5778
82 Ga0453684_0059181 3300044712 Bacteria 4942
83 Ga0453684_0074172 3300044712 Bacteria 4286
84 Ga0453684_0182779 3300044712 Unclassified 2460
85 Ga0453684_0192000 3300044712 Bacteria 2388
86 Ga0453684_0274901 3300044712 Bacteria 1923
87 Ga0453684_0282280 3300044712 Bacteria 1893
88 Ga0453684_0367579 3300044712 Bacteria 1618
89 Ga0453684_0376272 3300044712 Bacteria 1595
90 Ga0453684_0448581 3300044712 Bacteria 1436
91 Ga0451576_0000001 3300045051 Bacteria 1802108
92 Ga0451576_0000016 3300045051 Bacteria 565050
93 Ga0451576_0000299 3300045051 Bacteria 120013
94 Ga0451576_0000964 3300045051 Bacteria 53836
95 Ga0451576_0013205 3300045051 Bacteria 9242
96 Ga0451576_0018074 3300045051 Bacteria 7737
97 Ga0451576_0028704 3300045051 Bacteria 5957
98 Ga0451576_0049792 3300045051 Unclassified 4396
99 Ga0451576_0105525 3300045051 Bacteria 2931
100 Ga0451576_0171816 3300045051 Bacteria 2262
101 Ga0451576_0218757 3300045051 Bacteria 1989
102 Ga0451576_1496685 3300045051 Bacteria 701
103 Ga0496122_0078937 3300048925 Bacteria 2303
104 Ga0501031_0010595 3300049568 Bacteria 6001
105 Ga0501032_0022694 3300049569 Bacteria 4349
106 Ga0501033_0013915 3300049570 Bacteria 6122
107 Ga0501036_0063253 3300049572 Bacteria 3133
108 Ga0501036_0273686 3300049572 Unclassified 1413
109 Ga0501037_0035935 3300049573 Bacteria 3651
110 Ga0501039_0213982 3300049575 Archaea 1515
111 Ga0501040_0008506 3300049576 Bacteria 6663
112 Ga0501040_0087472 3300049576 Bacteria 2163
113 Ga0501041_0047339 3300049577 Bacteria 2617
114 Ga0501041_0199124 3300049577 Unclassified 1255
115 Ga0501042_0007004 3300049578 Bacteria 7362
116 Ga0501042_0066918 3300049578 Unclassified 2568
117 Ga0501042_0341760 3300049578 Unclassified 1082
118 Ga0501046_0264254 3300049580 Archaea 1263
119 Ga0501048_0031259 3300049582 Bacteria 3851
120 Ga0501068_0009296 3300049584 Bacteria 5495
121 Ga0501071_0065418 3300049587 Unclassified 2640
122 Ga0501072_0025166 3300049588 Unclassified 4635
123 Ga0501073_0016434 3300049589 Bacteria 5362
124 Ga0501074_0202245 3300049590 Archaea 1415
125 Ga0501075_0050491 3300049591 Bacteria 3126
126 Ga0501075_0051392 3300049591 Unclassified 3099
127 Ga0501075_0168288 3300049591 Bacteria 1672
128 Ga0501076_0019251 3300049592 Archaea 5215
129 Ga0501076_0319504 3300049592 Bacteria 1273
130 Ga0501076_0445895 3300049592 Unclassified 1065
131 Ga0501076_0545385 3300049592 Unclassified 956
132 Ga0501077_0023129 3300049593 Bacteria 3940
133 Ga0501079_0016666 3300049741 Bacteria 5610
134 Ga0501080_0051708 3300049742 Unclassified 3824
135 Ga0501080_0911726 3300049742 Archaea 765
136 Ga0501081_0096701 3300049743 Eukaryota 2083
137 Ga0501081_0097044 3300049743 Bacteria 2079
138 Ga0501083_0035207 3300049744 Bacteria 3420
139 Ga0501083_0085704 3300049744 Unclassified 2084
140 Ga0501044_0021419 3300049823 Bacteria 6896
141 Ga0501045_0216952 3300049824 Bacteria 1425
142 Ga0501045_0324584 3300049824 Unclassified 1145
143 nmdc:mga0qj67_95540_c1 3300050509 Bacteria 2392
144 Ga0501084_0030709 3300054114 Unclassified 4493
145 Ga0501084_0359558 3300054114 Unclassified 1230
146 Ga0501084_0567063 3300054114 Bacteria 959
147 Ga0590071_028136 3300059421 Bacteria 1335
148 Ga0590075_001149 3300059424 Bacteria 6723
149 Ga0590077_002989 3300059426 Bacteria 3542
150 Ga0501082_0183048 3300060353 Unclassified 1822
151 Ga0530510_0086003 3300061734 Unclassified 2291
152 Ga0530510_0106783 3300061734 Unclassified 2049
153 Ga0530510_0168304 3300061734 Unclassified 1623
154 2884636719 2884634485 Bacteria 3928637
155 Ga0453684_0008224
156 Ga0075430_100069673
157 Ga0316575_10001889
158 Ga0316575_10015661
159 Ga0316575_10030904
160 Ga0316579_10051995
161 Ga0316579_10108213
162 Ga0316579_10160574
163 Ga0316576_10007990
164 Ga0316576_10011265
165 Ga0316576_10039897
166 Ga0316576_10041023
167 Ga0316576_10043220
168 Ga0316576_10081974
169 Ga0316576_10102466
170 Ga0316576_10119388
171 Ga0316576_10126350
172 Ga0316578_10007673
173 Ga0316578_10030585
174 Ga0316578_10173402
175 Ga0316578_10274230
176 Ga0316577_10008633
177 Ga0316577_10010075
178 Ga0316577_10026148
179 Ga0316577_10083500
180 Ga0307413_10165305
181 Ga0307410_10009665
182 Ga0307410_10131321
183 Ga0307410_10168118
184 Ga0307406_10227505
185 Ga0307407_10038926
186 Ga0307409_100090190
187 Ga0307414_10079371
188 Ga0307411_10187003
189 Ga0307411_10259224
190 Ga0316583_10002616
191 Ga0316585_10006613
192 Ga0316596_1041128
193 Ga0316574_0006370
194 Ga0316574_0019426
195 Ga0316574_0071632
196 Ga0316574_0095500
197 Ga0316574_0130704
198 Ga0316574_0146348
199 Ga0316574_0165182
200 Ga0316582_0000990
201 Ga0316582_0010300
202 Ga0316582_0025371
203 Ga0316582_0029362
204 Ga0316582_0030793
205 Ga0316582_0038384
206 Ga0316582_0054127
207 Ga0316584_0005387
208 Ga0316584_0009843
209 Ga0316584_0023380
210 Ga0316584_0043761
211 Ga0316584_0297191
212 Ga0316581_0001179
213 Ga0316581_0001974
214 Ga0316581_0078501
215 Ga0450910_006359
216 Ga0451577_0061490
217 Ga0451577_0658053
218 Ga0453683_0000015
219 Ga0453683_0000162
220 Ga0453683_0000177
221 Ga0453683_0033676
222 Ga0453683_0075081
223 Ga0453683_0147108
224 Ga0453683_0187828
225 Ga0453683_0296807
226 Ga0453683_0306580
227 Ga0453683_0374321
228 Ga0453684_0000666
229 Ga0453684_0007810
230 Ga0453684_0009445
231 Ga0453684_0017613
232 Ga0453684_0024664
233 Ga0453684_0033646
234 Ga0453684_0034075
235 Ga0453684_0046401
236 Ga0453684_0059181
237 Ga0453684_0074172
238 Ga0453684_0182779
239 Ga0453684_0192000
240 Ga0453684_0274901
241 Ga0453684_0282280
242 Ga0453684_0367579
243 Ga0453684_0376272
244 Ga0453684_0448581
245 Ga0451576_0000001
246 Ga0451576_0000016
247 Ga0451576_0000299
248 Ga0451576_0000964
249 Ga0451576_0013205
250 Ga0451576_0018074
251 Ga0451576_0028704
252 Ga0451576_0049792
253 Ga0451576_0105525
254 Ga0451576_0171816
255 Ga0451576_0218757
256 Ga0451576_1496685
257 Ga0496122_0078937
258 Ga0501031_0010595
259 Ga0501032_0022694
260 Ga0501033_0013915
261 Ga0501036_0063253
262 Ga0501036_0273686
263 Ga0501037_0035935
264 Ga0501039_0213982
265 Ga0501040_0008506
266 Ga0501040_0087472
267 Ga0501041_0047339
268 Ga0501041_0199124
269 Ga0501042_0007004
270 Ga0501042_0066918
271 Ga0501042_0341760
272 Ga0501046_0264254
273 Ga0501048_0031259
274 Ga0501068_0009296
275 Ga0501071_0065418
276 Ga0501072_0025166
277 Ga0501073_0016434
278 Ga0501074_0202245
279 Ga0501075_0050491
280 Ga0501075_0051392
281 Ga0501075_0168288
282 Ga0501076_0019251
283 Ga0501076_0319504
284 Ga0501076_0445895
285 Ga0501076_0545385
286 Ga0501077_0023129
287 Ga0501079_0016666
288 Ga0501080_0051708
289 Ga0501080_0911726
290 Ga0501081_0096701
291 Ga0501081_0097044
292 Ga0501083_0035207
293 Ga0501083_0085704
294 Ga0501044_0021419
295 Ga0501045_0216952
296 Ga0501045_0324584
297 nmdc:mga0qj67_95540_c1
298 Ga0501084_0030709
299 Ga0501084_0359558
300 Ga0501084_0567063
301 Ga0590071_028136
302 Ga0590075_001149
303 Ga0590077_002989
304 Ga0501082_0183048
305 Ga0530510_0086003
306 Ga0530510_0106783
307 Ga0530510_0168304
308 2884636719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02535

Zip

ZIP Zinc transporter

184

270

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z6n-assembly1.cif.gz_A crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.8029 2 233
7z6m-assembly1.cif.gz_A-2 crystal structure of zn2+-transporter bbzip in a cadmium bound state 0.7987 9 231
8ght-assembly1.cif.gz_B cryo-electron microscopy structure of the zinc transporter from bordetella bronchiseptica 0.7976 2 233
7z6n-assembly1.cif.gz_A crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.7965 2 233
8ght-assembly1.cif.gz_B cryo-electron microscopy structure of the zinc transporter from bordetella bronchiseptica 0.7914 2 233
ID Description Score Start End Superfamily
af_M0RA42_232_457_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5406 25 231 1.20.1250.20
af_Q9HAB3_1_272_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5083 40 230 1.20.1250.20
af_Q9VWJ0_419_609_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.494 36 233 1.20.1250.20
af_Q54M69_132_348_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4792 37 232 1.20.1250.20
af_Q9VWJ0_419_609_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4098 36 233 1.20.1250.20
ID Description Score Start End GO Terms
AF-Q7UV47-F1-model_v4 GufA protein 0.9041 1 233 GO:0005385
GO:0012505
GO:0016020
GO:0071577
AF-Q7UV47-F1-model_v4 GufA protein 0.9004 1 233 GO:0005385
GO:0012505
GO:0016020
GO:0071577
AF-J7SVU7-F1-model_v4 deleted 0.8892 3 233
AF-A0A832D994-F1-model_v4 ZIP family metal transporter 0.8889 10 231 GO:0005385
GO:0012505
GO:0016020
AF-H0UMY5-F1-model_v4 Putative divalent heavy-metal cations transporter 0.8887 2 233 GO:0007155
GO:0016020
GO:0046872
GO:0046873

Map