F220194

General Info

Members Datasets Scaffolds Average Seq Length
154 110 308 193

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0554679|Ga0395901_0554679_217_831
Length 204
Sequence VNREFFDRSVHEVARDLIGCRLAVGETAGIIVETEAYEASDPACHAYIGRTVRNEVLFGPPGHAYVYLSYGIHSLLNFVTEPEGTASAVLIRALEPTEGIELMRERRGRSARARAGATRLGLEQLCSGPGKLSEALGVGLSLNGADLFEPPFMLSSPVGEWASAEVTTGPRIGITKAAELPWRYCVSGSAYVSRPWPVSAERAA

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
29 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
41 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
42 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
43 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
44 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
45 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
46 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
47 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
48 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
49 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
50 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
51 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
52 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
53 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
54 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
57 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
58 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
67 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
68 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
69 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
70 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
71 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
72 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
73 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
74 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
78 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
82 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
83 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
84 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
85 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
86 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
110 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 13.64
Rhizosphere 80.52
Stem 0
Stem Tuber 0
Unclassified 3.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0554679 3300038443 Bacteria 1164
2 JGI25407J50210_10033293 3300003373 Bacteria 1331
3 Ga0070714_100109388 3300005435 Bacteria 2445
4 Ga0070713_100076724 3300005436 Bacteria 2839
5 Ga0070710_10004904 3300005437 Bacteria 6330
6 Ga0070711_100145561 3300005439 Bacteria 1781
7 Ga0070678_100023049 3300005456 Bacteria 4141
8 Ga0070684_100128654 3300005535 Bacteria 2283
9 Ga0070686_100011113 3300005544 Bacteria 5101
10 Ga0070664_100147171 3300005564 Bacteria 2078
11 Ga0081455_10037189 3300005937 Bacteria 4326
12 Ga0081455_10052911 3300005937 Bacteria 3472
13 Ga0081455_10087136 3300005937 Unclassified 2541
14 Ga0081538_10002913 3300005981 Bacteria 16314
15 Ga0081540_1057814 3300005983 Bacteria 1873
16 Ga0081539_10160463 3300005985 Unclassified 1072
17 Ga0070715_10205492 3300006163 Bacteria 1003
18 Ga0070712_100005874 3300006175 Bacteria 7599
19 Ga0075435_100262364 3300007076 Bacteria 1472
20 Ga0105245_10001341 3300009098 Bacteria 22297
21 Ga0105245_10021369 3300009098 Bacteria 5676
22 Ga0114129_10771273 3300009147 Bacteria 1229
23 Ga0114129_11367088 3300009147 Bacteria 875
24 Ga0105243_11216312 3300009148 Bacteria 767
25 Ga0105248_11184905 3300009177 Bacteria 864
26 Ga0105249_10876821 3300009553 Bacteria 964
27 Ga0157371_10006801 3300013102 Bacteria 9348
28 Ga0157369_10000078 3300013105 Bacteria 135173
29 Ga0157378_10015700 3300013297 Bacteria 6631
30 Ga0157372_10005056 3300013307 Bacteria 14012
31 Ga0157372_10776802 3300013307 Bacteria 1113
32 Ga0157375_10113059 3300013308 Bacteria 2816
33 Ga0157377_10631263 3300014745 Bacteria 768
34 Ga0206353_10795151 3300020082 Unclassified 1445
35 Ga0213876_10359019 3300021384 Bacteria 775
36 Ga0207699_10037301 3300025906 Bacteria 2777
37 Ga0207705_10264876 3300025909 Bacteria 1313
38 Ga0207693_10017642 3300025915 Bacteria 5691
39 Ga0207687_10000031 3300025927 Bacteria 150246
40 Ga0207687_10027856 3300025927 Bacteria 3793
41 Ga0207664_10020412 3300025929 Bacteria 4910
42 Ga0207664_10030425 3300025929 Bacteria 4122
43 Ga0207704_10000103 3300025938 Bacteria 47628
44 Ga0207679_10041182 3300025945 Bacteria 3310
45 Ga0207675_100110841 3300026118 Bacteria 2589
46 Ga0207683_10099949 3300026121 Bacteria 2589
47 Ga0207683_10372410 3300026121 Bacteria 1312
48 Ga0307409_101078596 3300031995 Bacteria 824
49 Ga0307415_100219978 3300032126 Bacteria 1522
50 Ga0307415_101125295 3300032126 Bacteria 736
51 Ga0373953_0057970 3300035117 Bacteria 1578
52 Ga0373954_0317827 3300035118 Bacteria 769
53 Ga0373956_0262740 3300035119 Bacteria 821
54 Ga0373937_1205188 3300036401 Bacteria 705
55 Ga0395900_0163198 3300037418 Bacteria 2272
56 Ga0395900_0680985 3300037418 Bacteria 963
57 Ga0436364_0322671 3300037853 Bacteria 1515
58 Ga0395901_0033694 3300038443 Bacteria 5288
59 Ga0395901_0371450 3300038443 Bacteria 1473
60 Ga0395901_0669600 3300038443 Bacteria 1039
61 Ga0436365_0747824 3300039437 Bacteria 2087
62 Ga0436365_1356644 3300039437 Bacteria 3274
63 Ga0436365_1813960 3300039437 Bacteria 1141
64 Ga0436363_0628509 3300039450 Unclassified 1104
65 Ga0436363_1135330 3300039450 Bacteria 1165
66 Ga0436362_0425896 3300039453 Bacteria 804
67 Ga0436362_0492226 3300039453 Bacteria 1891
68 Ga0451853_1624344 3300041512 Bacteria 1779
69 Ga0466969_0053300 3300044656 Bacteria 1985
70 Ga0466965_0503696 3300044683 Bacteria 679
71 Ga0466966_0026623 3300044684 Bacteria 3776
72 Ga0466966_0294813 3300044684 Bacteria 975
73 Ga0466961_0003770 3300044693 Bacteria 9476
74 Ga0466961_0066110 3300044693 Bacteria 2297
75 Ga0466963_0002714 3300044694 Bacteria 9977
76 Ga0466963_0009352 3300044694 Bacteria 5900
77 Ga0466963_0047357 3300044694 Bacteria 2837
78 Ga0466963_0199460 3300044694 Bacteria 1400
79 Ga0466971_0203653 3300044719 Bacteria 934
80 Ga0466968_0002015 3300044735 Bacteria 7385
81 Ga0466968_0024551 3300044735 Bacteria 2464
82 Ga0466970_0032742 3300044765 Bacteria 2747
83 Ga0466970_0064085 3300044765 Bacteria 1971
84 Ga0466970_0160884 3300044765 Bacteria 1242
85 Ga0466957_0003140 3300044842 Bacteria 9001
86 Ga0466957_0090360 3300044842 Bacteria 1918
87 Ga0466957_0157252 3300044842 Bacteria 1474
88 Ga0466960_0602646 3300044901 Bacteria 652
89 Ga0466959_0012285 3300045049 Bacteria 6182
90 Ga0466959_0073594 3300045049 Bacteria 2471
91 Ga0466958_0002965 3300045836 Bacteria 8692
92 Ga0466958_0143638 3300045836 Bacteria 1503
93 Ga0466958_0228981 3300045836 Bacteria 1186
94 Ga0466967_0470074 3300045976 Bacteria 1231
95 Ga0466967_0508893 3300045976 Bacteria 1182
96 Ga0495629_0000999 3300046459 Bacteria 22693
97 Ga0495651_0015383 3300046462 Bacteria 5916
98 Ga0495662_0000133 3300046476 Bacteria 28271
99 Ga0495664_0173583 3300046477 Bacteria 1308
100 Ga0495608_0000036 3300046511 Bacteria 129609
101 Ga0495608_0006379 3300046511 Bacteria 8372
102 Ga0495628_0175693 3300046516 Bacteria 1622
103 Ga0495644_0237276 3300046523 Bacteria 707
104 Ga0495652_0012673 3300046529 Bacteria 7595
105 Ga0495667_0022620 3300046559 Bacteria 4235
106 Ga0495668_0495813 3300046616 Bacteria 673
107 Ga0495635_0026795 3300046663 Bacteria 4009
108 Ga0495657_0000001 3300046675 Bacteria 445641
109 Ga0495657_0033609 3300046675 Bacteria 3569
110 Ga0495599_0053053 3300046678 Bacteria 2540
111 Ga0495623_0388983 3300046679 Bacteria 752
112 Ga0495604_0021392 3300047317 Bacteria 5164
113 Ga0495604_0162257 3300047317 Bacteria 1578
114 Ga0495674_0079903 3300047319 Bacteria 2807
115 Ga0495672_0005388 3300047320 Bacteria 10163
116 Ga0495680_0018134 3300047322 Bacteria 5985
117 Ga0495680_0227325 3300047322 Bacteria 1330
118 Ga0495675_0000515 3300047444 Bacteria 25086
119 Ga0495684_0455517 3300047471 Bacteria 888
120 Ga0495593_0039301 3300047673 Bacteria 2551
121 Ga0495602_0000166 3300048088 Bacteria 61220
122 Ga0495602_0092441 3300048088 Bacteria 2506
123 Ga0496100_0205925 3300048903 Bacteria 1436
124 Ga0496101_0014176 3300048904 Bacteria 5354
125 Ga0496102_0231634 3300048905 Bacteria 1741
126 Ga0496103_0021613 3300048906 Bacteria 3871
127 Ga0496104_0040006 3300048907 Bacteria 4392
128 Ga0496104_0064127 3300048907 Bacteria 3486
129 Ga0496106_0155859 3300048909 Bacteria 1803
130 Ga0496106_0504598 3300048909 Unclassified 972
131 Ga0496107_0026403 3300048910 Bacteria 4117
132 Ga0496107_0160596 3300048910 Bacteria 1665
133 Ga0496108_0436303 3300048911 Bacteria 1144
134 Ga0496109_0064113 3300048912 Bacteria 3362
135 Ga0496109_0064950 3300048912 Bacteria 3340
136 Ga0496109_0211673 3300048912 Bacteria 1823
137 Ga0496110_0246054 3300048913 Bacteria 1627
138 Ga0496112_0002699 3300048915 Bacteria 14349
139 Ga0496112_0002848 3300048915 Bacteria 14052
140 Ga0496113_0038950 3300048916 Bacteria 3497
141 Ga0496113_0149526 3300048916 Bacteria 1842
142 Ga0496114_0012283 3300048917 Bacteria 6852
143 Ga0496115_0008899 3300048918 Bacteria 7443
144 Ga0501039_0444623 3300049575 Bacteria 1018
145 Ga0501040_0760334 3300049576 Bacteria 701
146 Ga0501041_0071073 3300049577 Bacteria 2137
147 Ga0501042_0435745 3300049578 Bacteria 950
148 Ga0501072_0768009 3300049588 Bacteria 756
149 nmdc:mga0yw44_309522_c1 3300050492 Bacteria 1059
150 nmdc:mga08y16_1308850_c1 3300050511 Bacteria 691
151 Ga0495595_0000002 3300053084 Bacteria 445641
152 Ga0495595_0023696 3300053084 Bacteria 2705
153 Ga0495619_0001511 3300053085 Bacteria 15342
154 Ga0466962_0003111 3300061719 Bacteria 7886
155 Ga0395901_0554679
156 JGI25407J50210_10033293
157 Ga0070714_100109388
158 Ga0070713_100076724
159 Ga0070710_10004904
160 Ga0070711_100145561
161 Ga0070678_100023049
162 Ga0070684_100128654
163 Ga0070686_100011113
164 Ga0070664_100147171
165 Ga0081455_10037189
166 Ga0081455_10052911
167 Ga0081455_10087136
168 Ga0081538_10002913
169 Ga0081540_1057814
170 Ga0081539_10160463
171 Ga0070715_10205492
172 Ga0070712_100005874
173 Ga0075435_100262364
174 Ga0105245_10001341
175 Ga0105245_10021369
176 Ga0114129_10771273
177 Ga0114129_11367088
178 Ga0105243_11216312
179 Ga0105248_11184905
180 Ga0105249_10876821
181 Ga0157371_10006801
182 Ga0157369_10000078
183 Ga0157378_10015700
184 Ga0157372_10005056
185 Ga0157372_10776802
186 Ga0157375_10113059
187 Ga0157377_10631263
188 Ga0206353_10795151
189 Ga0213876_10359019
190 Ga0207699_10037301
191 Ga0207705_10264876
192 Ga0207693_10017642
193 Ga0207687_10000031
194 Ga0207687_10027856
195 Ga0207664_10020412
196 Ga0207664_10030425
197 Ga0207704_10000103
198 Ga0207679_10041182
199 Ga0207675_100110841
200 Ga0207683_10099949
201 Ga0207683_10372410
202 Ga0307409_101078596
203 Ga0307415_100219978
204 Ga0307415_101125295
205 Ga0373953_0057970
206 Ga0373954_0317827
207 Ga0373956_0262740
208 Ga0373937_1205188
209 Ga0395900_0163198
210 Ga0395900_0680985
211 Ga0436364_0322671
212 Ga0395901_0033694
213 Ga0395901_0371450
214 Ga0395901_0669600
215 Ga0436365_0747824
216 Ga0436365_1356644
217 Ga0436365_1813960
218 Ga0436363_0628509
219 Ga0436363_1135330
220 Ga0436362_0425896
221 Ga0436362_0492226
222 Ga0451853_1624344
223 Ga0466969_0053300
224 Ga0466965_0503696
225 Ga0466966_0026623
226 Ga0466966_0294813
227 Ga0466961_0003770
228 Ga0466961_0066110
229 Ga0466963_0002714
230 Ga0466963_0009352
231 Ga0466963_0047357
232 Ga0466963_0199460
233 Ga0466971_0203653
234 Ga0466968_0002015
235 Ga0466968_0024551
236 Ga0466970_0032742
237 Ga0466970_0064085
238 Ga0466970_0160884
239 Ga0466957_0003140
240 Ga0466957_0090360
241 Ga0466957_0157252
242 Ga0466960_0602646
243 Ga0466959_0012285
244 Ga0466959_0073594
245 Ga0466958_0002965
246 Ga0466958_0143638
247 Ga0466958_0228981
248 Ga0466967_0470074
249 Ga0466967_0508893
250 Ga0495629_0000999
251 Ga0495651_0015383
252 Ga0495662_0000133
253 Ga0495664_0173583
254 Ga0495608_0000036
255 Ga0495608_0006379
256 Ga0495628_0175693
257 Ga0495644_0237276
258 Ga0495652_0012673
259 Ga0495667_0022620
260 Ga0495668_0495813
261 Ga0495635_0026795
262 Ga0495657_0000001
263 Ga0495657_0033609
264 Ga0495599_0053053
265 Ga0495623_0388983
266 Ga0495604_0021392
267 Ga0495604_0162257
268 Ga0495674_0079903
269 Ga0495672_0005388
270 Ga0495680_0018134
271 Ga0495680_0227325
272 Ga0495675_0000515
273 Ga0495684_0455517
274 Ga0495593_0039301
275 Ga0495602_0000166
276 Ga0495602_0092441
277 Ga0496100_0205925
278 Ga0496101_0014176
279 Ga0496102_0231634
280 Ga0496103_0021613
281 Ga0496104_0040006
282 Ga0496104_0064127
283 Ga0496106_0155859
284 Ga0496106_0504598
285 Ga0496107_0026403
286 Ga0496107_0160596
287 Ga0496108_0436303
288 Ga0496109_0064113
289 Ga0496109_0064950
290 Ga0496109_0211673
291 Ga0496110_0246054
292 Ga0496112_0002699
293 Ga0496112_0002848
294 Ga0496113_0038950
295 Ga0496113_0149526
296 Ga0496114_0012283
297 Ga0496115_0008899
298 Ga0501039_0444623
299 Ga0501040_0760334
300 Ga0501041_0071073
301 Ga0501042_0435745
302 Ga0501072_0768009
303 nmdc:mga0yw44_309522_c1
304 nmdc:mga08y16_1308850_c1
305 Ga0495595_0000002
306 Ga0495595_0023696
307 Ga0495619_0001511
308 Ga0466962_0003111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02245

Pur_DNA_glyco

Methylpurine-DNA glycosylase (MPG)

4

190

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f6o-assembly1.cif.gz_A crystal structure of the human aag dna repair glycosylase complexed with dna 0.924 19 206
3qi5-assembly2.cif.gz_B crystal structure of human alkyladenine dna glycosylase in complex with 3,n4-ethenocystosine containing duplex dna 0.9119 19 207
3uby-assembly1.cif.gz_A crystal structure of human alklyadenine dna glycosylase in a lower and higher-affinity complex with dna 0.8976 19 206
1f4r-assembly1.cif.gz_A crystal structure of the human aag dna repair glycosylase complexed with 1,n6-ethenoadenine-dna 0.8961 19 206
3qi5-assembly1.cif.gz_A crystal structure of human alkyladenine dna glycosylase in complex with 3,n4-ethenocystosine containing duplex dna 0.8915 19 207
ID Description Score Start End Superfamily
af_P9WJP7_1_198_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9309 21 202 3.10.300.10
af_Q0DX49_88_284_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9122 18 208 3.10.300.10
af_Q8IKG6_109_302_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9101 37 155 3.10.300.10
af_Q2FVS1_1_195_3.10.300.10 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.9021 25 207 3.10.300.10
1f4rA00 Alpha Beta;Roll;3-methyladenine DNA Glycosylase; Chain A;Methylpurine-DNA glycosylase (MPG) 0.8961 19 206 3.10.300.10
ID Description Score Start End GO Terms
AF-A0A4Q6DMS8-F1-model_v4 deleted 0.9963 26 146
AF-A0A538A4D9-F1-model_v4 DNA-3-methyladenine glycosylase (EC 3.2.2.-) 0.9956 19 194 GO:0003677
GO:0003905
GO:0006284
AF-A0A7V9DFY9-F1-model_v4 DNA-3-methyladenine glycosylase (EC 3.2.2.-) 0.9939 21 157 GO:0003677
GO:0003905
GO:0006284
AF-A0A4Y9S3W7-F1-model_v4 DNA-3-methyladenine glycosylase 0.9932 26 140 GO:0003677
GO:0003905
GO:0006284
AF-A0A7V8XKR0-F1-model_v4 Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-) 0.9928 19 206 GO:0003677
GO:0003905
GO:0006284

Map