F219959

General Info

Members Datasets Scaffolds Average Seq Length
154 99 308 232

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10062002|Ga0265338_100620023
Length 258
Sequence VEPEEWHLPASVSAFRILPSALLPVVRLQKFLAEAGVASRRAGEQIILARRVAVNGEVVRQLGTKVDPSHDRVTVDGQPVRAKRKLYLALHKTRGCVCSRQDELGRPTVYDSLPKEWTGLYSVGRLDYDTEGLLFLTNDGEFALRLTHPRYEVRKKYVVTVEGRVAVELLERIKHGVFHLGETLKAEKARLISSSLSRSIVELELTEGKNREVRRLFESQGVSVKRLQRTQIGKIKLGELKPGKWRALTEPEINSLLG

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
39 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
40 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
41 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
42 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
43 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
44 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
45 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
46 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
49 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
50 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
51 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
52 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
53 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
54 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
55 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
64 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
65 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
66 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
69 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
70 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
71 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
72 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
73 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
74 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
75 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
76 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
77 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
78 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
81 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
82 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
83 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
84 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
85 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
99 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 29.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10062002 3300028800 Bacteria 3272
2 Ga0070658_10178245 3300005327 Unclassified 1788
3 Ga0070690_100062567 3300005330 Bacteria 2400
4 Ga0068868_100326946 3300005338 Unclassified 1307
5 Ga0070689_100184222 3300005340 Bacteria 1697
6 Ga0070691_10054677 3300005341 Bacteria 1911
7 Ga0070691_10084601 3300005341 Bacteria 1557
8 Ga0070708_100051041 3300005445 Bacteria 3664
9 Ga0070679_100311732 3300005530 Unclassified 1523
10 Ga0068855_100026156 3300005563 Bacteria 6981
11 Ga0068855_100039002 3300005563 Bacteria 5640
12 Ga0068855_100202093 3300005563 Bacteria 2236
13 Ga0068857_100276221 3300005577 Unclassified 1545
14 Ga0068856_100032021 3300005614 Bacteria 5146
15 Ga0068863_100006428 3300005841 Bacteria 11523
16 Ga0097621_100074350 3300006237 Bacteria 2815
17 Ga0068871_100049643 3300006358 Bacteria 3392
18 Ga0097620_100629475 3300006931 Unclassified 1165
19 Ga0075435_100291615 3300007076 Unclassified 1394
20 Ga0105240_10022518 3300009093 Bacteria 8349
21 Ga0105240_10103426 3300009093 Bacteria 3461
22 Ga0111539_10148141 3300009094 Bacteria 2748
23 Ga0105245_10366563 3300009098 Unclassified 1431
24 Ga0114129_10619545 3300009147 Unclassified 1400
25 Ga0105241_10334660 3300009174 Unclassified 1310
26 Ga0105248_10568126 3300009177 Bacteria 1279
27 Ga0105238_10087429 3300009551 Unclassified 3104
28 Ga0157369_10216209 3300013105 Unclassified 2007
29 Ga0157380_10196775 3300014326 Unclassified 1785
30 Ga0207694_10049561 3300025924 Unclassified 3251
31 Ga0207687_10197378 3300025927 Bacteria 1570
32 Ga0207664_10367679 3300025929 Bacteria 1275
33 Ga0207670_10105830 3300025936 Bacteria 2017
34 Ga0207670_10150387 3300025936 Unclassified 1727
35 Ga0207711_10452046 3300025941 Bacteria 1196
36 Ga0207667_10021869 3300025949 Bacteria 7078
37 Ga0207667_10024048 3300025949 Bacteria 6699
38 Ga0207667_10127698 3300025949 Unclassified 2619
39 Ga0207677_10233458 3300026023 Unclassified 1483
40 Ga0207708_10130784 3300026075 Bacteria 1962
41 Ga0207702_10007637 3300026078 Bacteria 9202
42 Ga0207641_10057670 3300026088 Bacteria 3303
43 Ga0207674_10004387 3300026116 Bacteria 17004
44 Ga0207674_10395116 3300026116 Bacteria 1336
45 Ga0268265_10232840 3300028380 Bacteria 1620
46 Ga0265337_1000219 3300028556 Bacteria 30526
47 Ga0265337_1001814 3300028556 Bacteria 10247
48 Ga0265337_1007258 3300028556 Bacteria 4162
49 Ga0265337_1014163 3300028556 Unclassified 2651
50 Ga0265326_10080675 3300028558 Bacteria 920
51 Ga0265318_10080569 3300028577 Unclassified 1203
52 Ga0265323_10017960 3300028653 Bacteria 2742
53 Ga0265336_10002141 3300028666 Bacteria 8357
54 Ga0265336_10038695 3300028666 Bacteria 1463
55 Ga0265336_10064026 3300028666 Unclassified 1101
56 Ga0265336_10078255 3300028666 Unclassified 987
57 Ga0265338_10001491 3300028800 Bacteria 37899
58 Ga0265338_10001830 3300028800 Bacteria 33346
59 Ga0265338_10003065 3300028800 Bacteria 24008
60 Ga0265338_10003666 3300028800 Bacteria 21402
61 Ga0265338_10008576 3300028800 Bacteria 12370
62 Ga0265338_10009444 3300028800 Bacteria 11624
63 Ga0265338_10011005 3300028800 Bacteria 10506
64 Ga0265338_10017750 3300028800 Bacteria 7653
65 Ga0265338_10065758 3300028800 Unclassified 3142
66 Ga0265338_10426009 3300028800 Bacteria 942
67 Ga0265338_10561580 3300028800 Unclassified 798
68 Ga0265324_10007216 3300029957 Unclassified 4536
69 Ga0265324_10027204 3300029957 Bacteria 2020
70 Ga0265324_10085098 3300029957 Bacteria 1076
71 Ga0265320_10000303 3300031240 Bacteria 40288
72 Ga0265320_10002581 3300031240 Bacteria 12581
73 Ga0265320_10021408 3300031240 Unclassified 3478
74 Ga0265320_10169286 3300031240 Unclassified 982
75 Ga0265339_10015759 3300031249 Bacteria 4522
76 Ga0265331_10086465 3300031250 Unclassified 1452
77 Ga0265327_10001414 3300031251 Bacteria 30563
78 Ga0265327_10104411 3300031251 Unclassified 1362
79 Ga0265316_10018001 3300031344 Bacteria 6086
80 Ga0265316_10049791 3300031344 Bacteria 3298
81 Ga0265316_10070573 3300031344 Unclassified 2694
82 Ga0265314_10064883 3300031711 Unclassified 2469
83 Ga0265314_10078372 3300031711 Unclassified 2188
84 Ga0265342_10178342 3300031712 Bacteria 1165
85 Ga0373934_0034178 3300035086 Unclassified 1998
86 Ga0373953_0095611 3300035117 Bacteria 1246
87 Ga0373954_0109183 3300035118 Bacteria 1338
88 Ga0373956_0020132 3300035119 Bacteria 2836
89 Ga0373924_0138526 3300035410 Bacteria 1061
90 Ga0373927_0009691 3300035695 Bacteria 6459
91 Ga0373937_0007024 3300036401 Bacteria 9718
92 Ga0373925_0016953 3300037068 Bacteria 5273
93 Ga0453684_0112424 3300044712 Bacteria 3306
94 Ga0453684_0268311 3300044712 Bacteria 1952
95 Ga0453684_0766236 3300044712 Bacteria 1043
96 Ga0451576_0040069 3300045051 Bacteria 4960
97 Ga0451576_0864868 3300045051 Bacteria 949
98 Ga0451576_0878963 3300045051 Bacteria 941
99 Ga0495592_0434509 3300046454 Unclassified 825
100 Ga0495629_0155603 3300046459 Bacteria 1588
101 Ga0495653_0152965 3300046463 Unclassified 1610
102 Ga0495662_0240142 3300046476 Unclassified 893
103 Ga0495618_0012776 3300046514 Bacteria 5104
104 Ga0495628_0196855 3300046516 Unclassified 1520
105 Ga0495628_0549880 3300046516 Bacteria 829
106 Ga0495630_0019837 3300046517 Unclassified 4948
107 Ga0495630_0043339 3300046517 Bacteria 3361
108 Ga0495630_0118679 3300046517 Bacteria 2006
109 Ga0495666_0164177 3300046526 Bacteria 1029
110 Ga0495652_0285301 3300046529 Bacteria 1207
111 Ga0495640_0103115 3300046533 Bacteria 1871
112 Ga0495640_0217057 3300046533 Bacteria 1207
113 Ga0495586_0009184 3300046535 Bacteria 5260
114 Ga0495586_0121969 3300046535 Bacteria 1456
115 Ga0495587_0206210 3300046536 Bacteria 1111
116 Ga0495622_0015989 3300046557 Bacteria 3489
117 Ga0495667_0161337 3300046559 Bacteria 1442
118 Ga0495634_0003928 3300046642 Bacteria 11799
119 Ga0495634_0133486 3300046642 Bacteria 1581
120 Ga0495635_0014778 3300046663 Bacteria 5462
121 Ga0495599_0011307 3300046678 Bacteria 5482
122 Ga0495599_0023605 3300046678 Bacteria 3846
123 Ga0495599_0242481 3300046678 Bacteria 1099
124 Ga0495647_0052223 3300046681 Bacteria 1591
125 Ga0495613_0002257 3300046689 Bacteria 14566
126 Ga0495600_0254142 3300046809 Unclassified 1117
127 Ga0495674_0099040 3300047319 Bacteria 2482
128 Ga0495674_0381513 3300047319 Bacteria 1140
129 Ga0495680_0010253 3300047322 Bacteria 8364
130 Ga0495675_0128964 3300047444 Unclassified 1573
131 Ga0495684_0037137 3300047471 Bacteria 3736
132 Ga0495684_0135536 3300047471 Bacteria 1848
133 Ga0495684_0163774 3300047471 Bacteria 1658
134 Ga0495684_0267326 3300047471 Bacteria 1238
135 Ga0501031_0001214 3300049568 Bacteria 15755
136 Ga0501032_0032747 3300049569 Bacteria 3561
137 Ga0501032_0087161 3300049569 Unclassified 2074
138 Ga0501033_0003660 3300049570 Bacteria 12533
139 Ga0501034_0115482 3300049571 Bacteria 2673
140 Ga0501039_0058611 3300049575 Bacteria 2983
141 Ga0501043_0208781 3300049579 Unclassified 1514
142 Ga0501043_0299798 3300049579 Unclassified 1228
143 Ga0501047_0074206 3300049581 Bacteria 3275
144 Ga0501047_0362938 3300049581 Bacteria 1284
145 Ga0501080_0022559 3300049742 Bacteria 5833
146 Ga0501035_0040293 3300049822 Bacteria 4222
147 Ga0501035_0126234 3300049822 Unclassified 2233
148 Ga0501044_0000148 3300049823 Bacteria 86490
149 Ga0501044_0013372 3300049823 Bacteria 8875
150 nmdc:mga05p37_497648_c1 3300050507 Unclassified 1400
151 nmdc:mga06r32_321879_c1 3300050510 Unclassified 1532
152 nmdc:mga08y16_140305_c1 3300050511 Bacteria 2512
153 nmdc:mga0rr50_265920_c1 3300050513 Unclassified 1428
154 nmdc:mga0a205_263999_c1 3300050515 Unclassified 1599
155 Ga0265338_10062002
156 Ga0070658_10178245
157 Ga0070690_100062567
158 Ga0068868_100326946
159 Ga0070689_100184222
160 Ga0070691_10054677
161 Ga0070691_10084601
162 Ga0070708_100051041
163 Ga0070679_100311732
164 Ga0068855_100026156
165 Ga0068855_100039002
166 Ga0068855_100202093
167 Ga0068857_100276221
168 Ga0068856_100032021
169 Ga0068863_100006428
170 Ga0097621_100074350
171 Ga0068871_100049643
172 Ga0097620_100629475
173 Ga0075435_100291615
174 Ga0105240_10022518
175 Ga0105240_10103426
176 Ga0111539_10148141
177 Ga0105245_10366563
178 Ga0114129_10619545
179 Ga0105241_10334660
180 Ga0105248_10568126
181 Ga0105238_10087429
182 Ga0157369_10216209
183 Ga0157380_10196775
184 Ga0207694_10049561
185 Ga0207687_10197378
186 Ga0207664_10367679
187 Ga0207670_10105830
188 Ga0207670_10150387
189 Ga0207711_10452046
190 Ga0207667_10021869
191 Ga0207667_10024048
192 Ga0207667_10127698
193 Ga0207677_10233458
194 Ga0207708_10130784
195 Ga0207702_10007637
196 Ga0207641_10057670
197 Ga0207674_10004387
198 Ga0207674_10395116
199 Ga0268265_10232840
200 Ga0265337_1000219
201 Ga0265337_1001814
202 Ga0265337_1007258
203 Ga0265337_1014163
204 Ga0265326_10080675
205 Ga0265318_10080569
206 Ga0265323_10017960
207 Ga0265336_10002141
208 Ga0265336_10038695
209 Ga0265336_10064026
210 Ga0265336_10078255
211 Ga0265338_10001491
212 Ga0265338_10001830
213 Ga0265338_10003065
214 Ga0265338_10003666
215 Ga0265338_10008576
216 Ga0265338_10009444
217 Ga0265338_10011005
218 Ga0265338_10017750
219 Ga0265338_10065758
220 Ga0265338_10426009
221 Ga0265338_10561580
222 Ga0265324_10007216
223 Ga0265324_10027204
224 Ga0265324_10085098
225 Ga0265320_10000303
226 Ga0265320_10002581
227 Ga0265320_10021408
228 Ga0265320_10169286
229 Ga0265339_10015759
230 Ga0265331_10086465
231 Ga0265327_10001414
232 Ga0265327_10104411
233 Ga0265316_10018001
234 Ga0265316_10049791
235 Ga0265316_10070573
236 Ga0265314_10064883
237 Ga0265314_10078372
238 Ga0265342_10178342
239 Ga0373934_0034178
240 Ga0373953_0095611
241 Ga0373954_0109183
242 Ga0373956_0020132
243 Ga0373924_0138526
244 Ga0373927_0009691
245 Ga0373937_0007024
246 Ga0373925_0016953
247 Ga0453684_0112424
248 Ga0453684_0268311
249 Ga0453684_0766236
250 Ga0451576_0040069
251 Ga0451576_0864868
252 Ga0451576_0878963
253 Ga0495592_0434509
254 Ga0495629_0155603
255 Ga0495653_0152965
256 Ga0495662_0240142
257 Ga0495618_0012776
258 Ga0495628_0196855
259 Ga0495628_0549880
260 Ga0495630_0019837
261 Ga0495630_0043339
262 Ga0495630_0118679
263 Ga0495666_0164177
264 Ga0495652_0285301
265 Ga0495640_0103115
266 Ga0495640_0217057
267 Ga0495586_0009184
268 Ga0495586_0121969
269 Ga0495587_0206210
270 Ga0495622_0015989
271 Ga0495667_0161337
272 Ga0495634_0003928
273 Ga0495634_0133486
274 Ga0495635_0014778
275 Ga0495599_0011307
276 Ga0495599_0023605
277 Ga0495599_0242481
278 Ga0495647_0052223
279 Ga0495613_0002257
280 Ga0495600_0254142
281 Ga0495674_0099040
282 Ga0495674_0381513
283 Ga0495680_0010253
284 Ga0495675_0128964
285 Ga0495684_0037137
286 Ga0495684_0135536
287 Ga0495684_0163774
288 Ga0495684_0267326
289 Ga0501031_0001214
290 Ga0501032_0032747
291 Ga0501032_0087161
292 Ga0501033_0003660
293 Ga0501034_0115482
294 Ga0501039_0058611
295 Ga0501043_0208781
296 Ga0501043_0299798
297 Ga0501047_0074206
298 Ga0501047_0362938
299 Ga0501080_0022559
300 Ga0501035_0040293
301 Ga0501035_0126234
302 Ga0501044_0000148
303 Ga0501044_0013372
304 nmdc:mga05p37_497648_c1
305 nmdc:mga06r32_321879_c1
306 nmdc:mga08y16_140305_c1
307 nmdc:mga0rr50_265920_c1
308 nmdc:mga0a205_263999_c1

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

26

71

0.96

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

86

219

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wxm-assembly1.cif.gz_A crystal structure of the imp3 and mpp10 complex 0.9614 3 42
6nd4-assembly1.cif.gz_Z conformational switches control early maturation of the eukaryotic small ribosomal subunit 0.9395 3 42
8d8l-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 3) 0.9347 3 52
5mrc-assembly1.cif.gz_DD structure of the yeast mitochondrial ribosome - class a 0.9268 3 51
7mq9-assembly1.cif.gz_LZ cryo-em structure of the human ssu processome, state pre-a1* 0.9254 3 42
ID Description Score Start End Superfamily
af_P9WHQ1_10_70_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 1.009 2 56 3.10.290.10
af_Q2FY78_1_58_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9857 3 54 3.10.290.10
af_A0A1D6JNZ0_152_214_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.963 2 59 3.10.290.10
af_Q2FXH7_1_58_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.96 2 59 3.10.290.10
af_Q8I5D3_12_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9488 1 58 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A2G9YAW8-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9623 31 232 GO:0001522
GO:0003723
GO:0006364
GO:0009982
GO:0140098
AF-A0A2V5W5N6-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9617 1 235 GO:0000455
GO:0003723
GO:0120159
AF-A0A3S0DAI6-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9605 2 232 GO:0000455
GO:0003723
GO:0120159
AF-A0A2V5W5N6-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9538 1 235 GO:0000455
GO:0003723
GO:0120159
AF-A0A848A576-F1-model_v4 deleted 0.9528 2 233

Map