F219959
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 154 | 99 | 308 | 232 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10062002|Ga0265338_100620023 |
| Length | 258 |
| Sequence | VEPEEWHLPASVSAFRILPSALLPVVRLQKFLAEAGVASRRAGEQIILARRVAVNGEVVRQLGTKVDPSHDRVTVDGQPVRAKRKLYLALHKTRGCVCSRQDELGRPTVYDSLPKEWTGLYSVGRLDYDTEGLLFLTNDGEFALRLTHPRYEVRKKYVVTVEGRVAVELLERIKHGVFHLGETLKAEKARLISSSLSRSIVELELTEGKNREVRRLFESQGVSVKRLQRTQIGKIKLGELKPGKWRALTEPEINSLLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 10 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 11 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 12 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 13 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 14 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 15 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 16 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 17 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 19 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 39 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 40 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 41 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 42 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 43 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 44 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 45 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 46 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 47 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 48 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 49 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 50 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 51 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 52 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 53 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 54 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 55 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 56 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 57 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 58 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 59 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 60 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 61 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 62 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 63 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 86 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 87 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 88 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 89 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 90 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 91 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 92 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 93 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 94 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 95 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 96 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 97 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 98 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 99 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 100 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 29.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265338_10062002 | 3300028800 | Bacteria | 3272 |
| 2 | Ga0070658_10178245 | 3300005327 | Unclassified | 1788 |
| 3 | Ga0070690_100062567 | 3300005330 | Bacteria | 2400 |
| 4 | Ga0068868_100326946 | 3300005338 | Unclassified | 1307 |
| 5 | Ga0070689_100184222 | 3300005340 | Bacteria | 1697 |
| 6 | Ga0070691_10054677 | 3300005341 | Bacteria | 1911 |
| 7 | Ga0070691_10084601 | 3300005341 | Bacteria | 1557 |
| 8 | Ga0070708_100051041 | 3300005445 | Bacteria | 3664 |
| 9 | Ga0070679_100311732 | 3300005530 | Unclassified | 1523 |
| 10 | Ga0068855_100026156 | 3300005563 | Bacteria | 6981 |
| 11 | Ga0068855_100039002 | 3300005563 | Bacteria | 5640 |
| 12 | Ga0068855_100202093 | 3300005563 | Bacteria | 2236 |
| 13 | Ga0068857_100276221 | 3300005577 | Unclassified | 1545 |
| 14 | Ga0068856_100032021 | 3300005614 | Bacteria | 5146 |
| 15 | Ga0068863_100006428 | 3300005841 | Bacteria | 11523 |
| 16 | Ga0097621_100074350 | 3300006237 | Bacteria | 2815 |
| 17 | Ga0068871_100049643 | 3300006358 | Bacteria | 3392 |
| 18 | Ga0097620_100629475 | 3300006931 | Unclassified | 1165 |
| 19 | Ga0075435_100291615 | 3300007076 | Unclassified | 1394 |
| 20 | Ga0105240_10022518 | 3300009093 | Bacteria | 8349 |
| 21 | Ga0105240_10103426 | 3300009093 | Bacteria | 3461 |
| 22 | Ga0111539_10148141 | 3300009094 | Bacteria | 2748 |
| 23 | Ga0105245_10366563 | 3300009098 | Unclassified | 1431 |
| 24 | Ga0114129_10619545 | 3300009147 | Unclassified | 1400 |
| 25 | Ga0105241_10334660 | 3300009174 | Unclassified | 1310 |
| 26 | Ga0105248_10568126 | 3300009177 | Bacteria | 1279 |
| 27 | Ga0105238_10087429 | 3300009551 | Unclassified | 3104 |
| 28 | Ga0157369_10216209 | 3300013105 | Unclassified | 2007 |
| 29 | Ga0157380_10196775 | 3300014326 | Unclassified | 1785 |
| 30 | Ga0207694_10049561 | 3300025924 | Unclassified | 3251 |
| 31 | Ga0207687_10197378 | 3300025927 | Bacteria | 1570 |
| 32 | Ga0207664_10367679 | 3300025929 | Bacteria | 1275 |
| 33 | Ga0207670_10105830 | 3300025936 | Bacteria | 2017 |
| 34 | Ga0207670_10150387 | 3300025936 | Unclassified | 1727 |
| 35 | Ga0207711_10452046 | 3300025941 | Bacteria | 1196 |
| 36 | Ga0207667_10021869 | 3300025949 | Bacteria | 7078 |
| 37 | Ga0207667_10024048 | 3300025949 | Bacteria | 6699 |
| 38 | Ga0207667_10127698 | 3300025949 | Unclassified | 2619 |
| 39 | Ga0207677_10233458 | 3300026023 | Unclassified | 1483 |
| 40 | Ga0207708_10130784 | 3300026075 | Bacteria | 1962 |
| 41 | Ga0207702_10007637 | 3300026078 | Bacteria | 9202 |
| 42 | Ga0207641_10057670 | 3300026088 | Bacteria | 3303 |
| 43 | Ga0207674_10004387 | 3300026116 | Bacteria | 17004 |
| 44 | Ga0207674_10395116 | 3300026116 | Bacteria | 1336 |
| 45 | Ga0268265_10232840 | 3300028380 | Bacteria | 1620 |
| 46 | Ga0265337_1000219 | 3300028556 | Bacteria | 30526 |
| 47 | Ga0265337_1001814 | 3300028556 | Bacteria | 10247 |
| 48 | Ga0265337_1007258 | 3300028556 | Bacteria | 4162 |
| 49 | Ga0265337_1014163 | 3300028556 | Unclassified | 2651 |
| 50 | Ga0265326_10080675 | 3300028558 | Bacteria | 920 |
| 51 | Ga0265318_10080569 | 3300028577 | Unclassified | 1203 |
| 52 | Ga0265323_10017960 | 3300028653 | Bacteria | 2742 |
| 53 | Ga0265336_10002141 | 3300028666 | Bacteria | 8357 |
| 54 | Ga0265336_10038695 | 3300028666 | Bacteria | 1463 |
| 55 | Ga0265336_10064026 | 3300028666 | Unclassified | 1101 |
| 56 | Ga0265336_10078255 | 3300028666 | Unclassified | 987 |
| 57 | Ga0265338_10001491 | 3300028800 | Bacteria | 37899 |
| 58 | Ga0265338_10001830 | 3300028800 | Bacteria | 33346 |
| 59 | Ga0265338_10003065 | 3300028800 | Bacteria | 24008 |
| 60 | Ga0265338_10003666 | 3300028800 | Bacteria | 21402 |
| 61 | Ga0265338_10008576 | 3300028800 | Bacteria | 12370 |
| 62 | Ga0265338_10009444 | 3300028800 | Bacteria | 11624 |
| 63 | Ga0265338_10011005 | 3300028800 | Bacteria | 10506 |
| 64 | Ga0265338_10017750 | 3300028800 | Bacteria | 7653 |
| 65 | Ga0265338_10065758 | 3300028800 | Unclassified | 3142 |
| 66 | Ga0265338_10426009 | 3300028800 | Bacteria | 942 |
| 67 | Ga0265338_10561580 | 3300028800 | Unclassified | 798 |
| 68 | Ga0265324_10007216 | 3300029957 | Unclassified | 4536 |
| 69 | Ga0265324_10027204 | 3300029957 | Bacteria | 2020 |
| 70 | Ga0265324_10085098 | 3300029957 | Bacteria | 1076 |
| 71 | Ga0265320_10000303 | 3300031240 | Bacteria | 40288 |
| 72 | Ga0265320_10002581 | 3300031240 | Bacteria | 12581 |
| 73 | Ga0265320_10021408 | 3300031240 | Unclassified | 3478 |
| 74 | Ga0265320_10169286 | 3300031240 | Unclassified | 982 |
| 75 | Ga0265339_10015759 | 3300031249 | Bacteria | 4522 |
| 76 | Ga0265331_10086465 | 3300031250 | Unclassified | 1452 |
| 77 | Ga0265327_10001414 | 3300031251 | Bacteria | 30563 |
| 78 | Ga0265327_10104411 | 3300031251 | Unclassified | 1362 |
| 79 | Ga0265316_10018001 | 3300031344 | Bacteria | 6086 |
| 80 | Ga0265316_10049791 | 3300031344 | Bacteria | 3298 |
| 81 | Ga0265316_10070573 | 3300031344 | Unclassified | 2694 |
| 82 | Ga0265314_10064883 | 3300031711 | Unclassified | 2469 |
| 83 | Ga0265314_10078372 | 3300031711 | Unclassified | 2188 |
| 84 | Ga0265342_10178342 | 3300031712 | Bacteria | 1165 |
| 85 | Ga0373934_0034178 | 3300035086 | Unclassified | 1998 |
| 86 | Ga0373953_0095611 | 3300035117 | Bacteria | 1246 |
| 87 | Ga0373954_0109183 | 3300035118 | Bacteria | 1338 |
| 88 | Ga0373956_0020132 | 3300035119 | Bacteria | 2836 |
| 89 | Ga0373924_0138526 | 3300035410 | Bacteria | 1061 |
| 90 | Ga0373927_0009691 | 3300035695 | Bacteria | 6459 |
| 91 | Ga0373937_0007024 | 3300036401 | Bacteria | 9718 |
| 92 | Ga0373925_0016953 | 3300037068 | Bacteria | 5273 |
| 93 | Ga0453684_0112424 | 3300044712 | Bacteria | 3306 |
| 94 | Ga0453684_0268311 | 3300044712 | Bacteria | 1952 |
| 95 | Ga0453684_0766236 | 3300044712 | Bacteria | 1043 |
| 96 | Ga0451576_0040069 | 3300045051 | Bacteria | 4960 |
| 97 | Ga0451576_0864868 | 3300045051 | Bacteria | 949 |
| 98 | Ga0451576_0878963 | 3300045051 | Bacteria | 941 |
| 99 | Ga0495592_0434509 | 3300046454 | Unclassified | 825 |
| 100 | Ga0495629_0155603 | 3300046459 | Bacteria | 1588 |
| 101 | Ga0495653_0152965 | 3300046463 | Unclassified | 1610 |
| 102 | Ga0495662_0240142 | 3300046476 | Unclassified | 893 |
| 103 | Ga0495618_0012776 | 3300046514 | Bacteria | 5104 |
| 104 | Ga0495628_0196855 | 3300046516 | Unclassified | 1520 |
| 105 | Ga0495628_0549880 | 3300046516 | Bacteria | 829 |
| 106 | Ga0495630_0019837 | 3300046517 | Unclassified | 4948 |
| 107 | Ga0495630_0043339 | 3300046517 | Bacteria | 3361 |
| 108 | Ga0495630_0118679 | 3300046517 | Bacteria | 2006 |
| 109 | Ga0495666_0164177 | 3300046526 | Bacteria | 1029 |
| 110 | Ga0495652_0285301 | 3300046529 | Bacteria | 1207 |
| 111 | Ga0495640_0103115 | 3300046533 | Bacteria | 1871 |
| 112 | Ga0495640_0217057 | 3300046533 | Bacteria | 1207 |
| 113 | Ga0495586_0009184 | 3300046535 | Bacteria | 5260 |
| 114 | Ga0495586_0121969 | 3300046535 | Bacteria | 1456 |
| 115 | Ga0495587_0206210 | 3300046536 | Bacteria | 1111 |
| 116 | Ga0495622_0015989 | 3300046557 | Bacteria | 3489 |
| 117 | Ga0495667_0161337 | 3300046559 | Bacteria | 1442 |
| 118 | Ga0495634_0003928 | 3300046642 | Bacteria | 11799 |
| 119 | Ga0495634_0133486 | 3300046642 | Bacteria | 1581 |
| 120 | Ga0495635_0014778 | 3300046663 | Bacteria | 5462 |
| 121 | Ga0495599_0011307 | 3300046678 | Bacteria | 5482 |
| 122 | Ga0495599_0023605 | 3300046678 | Bacteria | 3846 |
| 123 | Ga0495599_0242481 | 3300046678 | Bacteria | 1099 |
| 124 | Ga0495647_0052223 | 3300046681 | Bacteria | 1591 |
| 125 | Ga0495613_0002257 | 3300046689 | Bacteria | 14566 |
| 126 | Ga0495600_0254142 | 3300046809 | Unclassified | 1117 |
| 127 | Ga0495674_0099040 | 3300047319 | Bacteria | 2482 |
| 128 | Ga0495674_0381513 | 3300047319 | Bacteria | 1140 |
| 129 | Ga0495680_0010253 | 3300047322 | Bacteria | 8364 |
| 130 | Ga0495675_0128964 | 3300047444 | Unclassified | 1573 |
| 131 | Ga0495684_0037137 | 3300047471 | Bacteria | 3736 |
| 132 | Ga0495684_0135536 | 3300047471 | Bacteria | 1848 |
| 133 | Ga0495684_0163774 | 3300047471 | Bacteria | 1658 |
| 134 | Ga0495684_0267326 | 3300047471 | Bacteria | 1238 |
| 135 | Ga0501031_0001214 | 3300049568 | Bacteria | 15755 |
| 136 | Ga0501032_0032747 | 3300049569 | Bacteria | 3561 |
| 137 | Ga0501032_0087161 | 3300049569 | Unclassified | 2074 |
| 138 | Ga0501033_0003660 | 3300049570 | Bacteria | 12533 |
| 139 | Ga0501034_0115482 | 3300049571 | Bacteria | 2673 |
| 140 | Ga0501039_0058611 | 3300049575 | Bacteria | 2983 |
| 141 | Ga0501043_0208781 | 3300049579 | Unclassified | 1514 |
| 142 | Ga0501043_0299798 | 3300049579 | Unclassified | 1228 |
| 143 | Ga0501047_0074206 | 3300049581 | Bacteria | 3275 |
| 144 | Ga0501047_0362938 | 3300049581 | Bacteria | 1284 |
| 145 | Ga0501080_0022559 | 3300049742 | Bacteria | 5833 |
| 146 | Ga0501035_0040293 | 3300049822 | Bacteria | 4222 |
| 147 | Ga0501035_0126234 | 3300049822 | Unclassified | 2233 |
| 148 | Ga0501044_0000148 | 3300049823 | Bacteria | 86490 |
| 149 | Ga0501044_0013372 | 3300049823 | Bacteria | 8875 |
| 150 | nmdc:mga05p37_497648_c1 | 3300050507 | Unclassified | 1400 |
| 151 | nmdc:mga06r32_321879_c1 | 3300050510 | Unclassified | 1532 |
| 152 | nmdc:mga08y16_140305_c1 | 3300050511 | Bacteria | 2512 |
| 153 | nmdc:mga0rr50_265920_c1 | 3300050513 | Unclassified | 1428 |
| 154 | nmdc:mga0a205_263999_c1 | 3300050515 | Unclassified | 1599 |
| 155 | Ga0265338_10062002 | |||
| 156 | Ga0070658_10178245 | |||
| 157 | Ga0070690_100062567 | |||
| 158 | Ga0068868_100326946 | |||
| 159 | Ga0070689_100184222 | |||
| 160 | Ga0070691_10054677 | |||
| 161 | Ga0070691_10084601 | |||
| 162 | Ga0070708_100051041 | |||
| 163 | Ga0070679_100311732 | |||
| 164 | Ga0068855_100026156 | |||
| 165 | Ga0068855_100039002 | |||
| 166 | Ga0068855_100202093 | |||
| 167 | Ga0068857_100276221 | |||
| 168 | Ga0068856_100032021 | |||
| 169 | Ga0068863_100006428 | |||
| 170 | Ga0097621_100074350 | |||
| 171 | Ga0068871_100049643 | |||
| 172 | Ga0097620_100629475 | |||
| 173 | Ga0075435_100291615 | |||
| 174 | Ga0105240_10022518 | |||
| 175 | Ga0105240_10103426 | |||
| 176 | Ga0111539_10148141 | |||
| 177 | Ga0105245_10366563 | |||
| 178 | Ga0114129_10619545 | |||
| 179 | Ga0105241_10334660 | |||
| 180 | Ga0105248_10568126 | |||
| 181 | Ga0105238_10087429 | |||
| 182 | Ga0157369_10216209 | |||
| 183 | Ga0157380_10196775 | |||
| 184 | Ga0207694_10049561 | |||
| 185 | Ga0207687_10197378 | |||
| 186 | Ga0207664_10367679 | |||
| 187 | Ga0207670_10105830 | |||
| 188 | Ga0207670_10150387 | |||
| 189 | Ga0207711_10452046 | |||
| 190 | Ga0207667_10021869 | |||
| 191 | Ga0207667_10024048 | |||
| 192 | Ga0207667_10127698 | |||
| 193 | Ga0207677_10233458 | |||
| 194 | Ga0207708_10130784 | |||
| 195 | Ga0207702_10007637 | |||
| 196 | Ga0207641_10057670 | |||
| 197 | Ga0207674_10004387 | |||
| 198 | Ga0207674_10395116 | |||
| 199 | Ga0268265_10232840 | |||
| 200 | Ga0265337_1000219 | |||
| 201 | Ga0265337_1001814 | |||
| 202 | Ga0265337_1007258 | |||
| 203 | Ga0265337_1014163 | |||
| 204 | Ga0265326_10080675 | |||
| 205 | Ga0265318_10080569 | |||
| 206 | Ga0265323_10017960 | |||
| 207 | Ga0265336_10002141 | |||
| 208 | Ga0265336_10038695 | |||
| 209 | Ga0265336_10064026 | |||
| 210 | Ga0265336_10078255 | |||
| 211 | Ga0265338_10001491 | |||
| 212 | Ga0265338_10001830 | |||
| 213 | Ga0265338_10003065 | |||
| 214 | Ga0265338_10003666 | |||
| 215 | Ga0265338_10008576 | |||
| 216 | Ga0265338_10009444 | |||
| 217 | Ga0265338_10011005 | |||
| 218 | Ga0265338_10017750 | |||
| 219 | Ga0265338_10065758 | |||
| 220 | Ga0265338_10426009 | |||
| 221 | Ga0265338_10561580 | |||
| 222 | Ga0265324_10007216 | |||
| 223 | Ga0265324_10027204 | |||
| 224 | Ga0265324_10085098 | |||
| 225 | Ga0265320_10000303 | |||
| 226 | Ga0265320_10002581 | |||
| 227 | Ga0265320_10021408 | |||
| 228 | Ga0265320_10169286 | |||
| 229 | Ga0265339_10015759 | |||
| 230 | Ga0265331_10086465 | |||
| 231 | Ga0265327_10001414 | |||
| 232 | Ga0265327_10104411 | |||
| 233 | Ga0265316_10018001 | |||
| 234 | Ga0265316_10049791 | |||
| 235 | Ga0265316_10070573 | |||
| 236 | Ga0265314_10064883 | |||
| 237 | Ga0265314_10078372 | |||
| 238 | Ga0265342_10178342 | |||
| 239 | Ga0373934_0034178 | |||
| 240 | Ga0373953_0095611 | |||
| 241 | Ga0373954_0109183 | |||
| 242 | Ga0373956_0020132 | |||
| 243 | Ga0373924_0138526 | |||
| 244 | Ga0373927_0009691 | |||
| 245 | Ga0373937_0007024 | |||
| 246 | Ga0373925_0016953 | |||
| 247 | Ga0453684_0112424 | |||
| 248 | Ga0453684_0268311 | |||
| 249 | Ga0453684_0766236 | |||
| 250 | Ga0451576_0040069 | |||
| 251 | Ga0451576_0864868 | |||
| 252 | Ga0451576_0878963 | |||
| 253 | Ga0495592_0434509 | |||
| 254 | Ga0495629_0155603 | |||
| 255 | Ga0495653_0152965 | |||
| 256 | Ga0495662_0240142 | |||
| 257 | Ga0495618_0012776 | |||
| 258 | Ga0495628_0196855 | |||
| 259 | Ga0495628_0549880 | |||
| 260 | Ga0495630_0019837 | |||
| 261 | Ga0495630_0043339 | |||
| 262 | Ga0495630_0118679 | |||
| 263 | Ga0495666_0164177 | |||
| 264 | Ga0495652_0285301 | |||
| 265 | Ga0495640_0103115 | |||
| 266 | Ga0495640_0217057 | |||
| 267 | Ga0495586_0009184 | |||
| 268 | Ga0495586_0121969 | |||
| 269 | Ga0495587_0206210 | |||
| 270 | Ga0495622_0015989 | |||
| 271 | Ga0495667_0161337 | |||
| 272 | Ga0495634_0003928 | |||
| 273 | Ga0495634_0133486 | |||
| 274 | Ga0495635_0014778 | |||
| 275 | Ga0495599_0011307 | |||
| 276 | Ga0495599_0023605 | |||
| 277 | Ga0495599_0242481 | |||
| 278 | Ga0495647_0052223 | |||
| 279 | Ga0495613_0002257 | |||
| 280 | Ga0495600_0254142 | |||
| 281 | Ga0495674_0099040 | |||
| 282 | Ga0495674_0381513 | |||
| 283 | Ga0495680_0010253 | |||
| 284 | Ga0495675_0128964 | |||
| 285 | Ga0495684_0037137 | |||
| 286 | Ga0495684_0135536 | |||
| 287 | Ga0495684_0163774 | |||
| 288 | Ga0495684_0267326 | |||
| 289 | Ga0501031_0001214 | |||
| 290 | Ga0501032_0032747 | |||
| 291 | Ga0501032_0087161 | |||
| 292 | Ga0501033_0003660 | |||
| 293 | Ga0501034_0115482 | |||
| 294 | Ga0501039_0058611 | |||
| 295 | Ga0501043_0208781 | |||
| 296 | Ga0501043_0299798 | |||
| 297 | Ga0501047_0074206 | |||
| 298 | Ga0501047_0362938 | |||
| 299 | Ga0501080_0022559 | |||
| 300 | Ga0501035_0040293 | |||
| 301 | Ga0501035_0126234 | |||
| 302 | Ga0501044_0000148 | |||
| 303 | Ga0501044_0013372 | |||
| 304 | nmdc:mga05p37_497648_c1 | |||
| 305 | nmdc:mga06r32_321879_c1 | |||
| 306 | nmdc:mga08y16_140305_c1 | |||
| 307 | nmdc:mga0rr50_265920_c1 | |||
| 308 | nmdc:mga0a205_263999_c1 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wxm-assembly1.cif.gz_A | crystal structure of the imp3 and mpp10 complex | 0.9614 | 3 | 42 |
| 6nd4-assembly1.cif.gz_Z | conformational switches control early maturation of the eukaryotic small ribosomal subunit | 0.9395 | 3 | 42 |
| 8d8l-assembly1.cif.gz_D | yeast mitochondrial small subunit assembly intermediate (state 3) | 0.9347 | 3 | 52 |
| 5mrc-assembly1.cif.gz_DD | structure of the yeast mitochondrial ribosome - class a | 0.9268 | 3 | 51 |
| 7mq9-assembly1.cif.gz_LZ | cryo-em structure of the human ssu processome, state pre-a1* | 0.9254 | 3 | 42 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHQ1_10_70_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 1.009 | 2 | 56 | 3.10.290.10 |
| af_Q2FY78_1_58_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9857 | 3 | 54 | 3.10.290.10 |
| af_A0A1D6JNZ0_152_214_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.963 | 2 | 59 | 3.10.290.10 |
| af_Q2FXH7_1_58_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.96 | 2 | 59 | 3.10.290.10 |
| af_Q8I5D3_12_67_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9488 | 1 | 58 | 3.10.290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G9YAW8-F1-model_v4 | Pseudouridine synthase (EC 5.4.99.-) | 0.9623 | 31 | 232 |
GO:0001522
GO:0003723 GO:0006364 GO:0009982 GO:0140098 |
| AF-A0A2V5W5N6-F1-model_v4 | Pseudouridine synthase (EC 5.4.99.-) | 0.9617 | 1 | 235 |
GO:0000455
GO:0003723 GO:0120159 |
| AF-A0A3S0DAI6-F1-model_v4 | Pseudouridine synthase (EC 5.4.99.-) | 0.9605 | 2 | 232 |
GO:0000455
GO:0003723 GO:0120159 |
| AF-A0A2V5W5N6-F1-model_v4 | Pseudouridine synthase (EC 5.4.99.-) | 0.9538 | 1 | 235 |
GO:0000455
GO:0003723 GO:0120159 |
| AF-A0A848A576-F1-model_v4 | deleted | 0.9528 | 2 | 233 |
|