F219902

General Info

Members Datasets Scaffolds Average Seq Length
154 82 154 275

Family's Representative Sequence

Representative Sequence 3300028558|Ga0265326_10006399|Ga0265326_100063993
Length 271
Sequence MTISSTGVKSRDSRRSIGDLLVPLNELATRSVNLVANHEAHFEIEGETYNFPRYLFIGSVSGEAPIRVGIFATIHGDEPEGAHAIAQFIEALEGRPEFAAGYYLSFYPLCNPTGYEDNTSHSRNGSDLDREFWKNSKQPEVQLLQAELVSQSFQGIISLRTDATSDGFYALVRGGGTLAKHLVEPSLRAVDEFLPRDSRLLIDGLRSRDGIVRDEPDGRLSAPPKVRPRPFEIVLTTPKAPPAFLKESALIVALQTILAEYRRFIAHAQNI

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
6 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
13 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
26 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
27 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
28 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
29 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
30 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
31 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
32 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
33 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
34 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
35 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
36 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
37 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
38 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
44 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
45 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
46 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
47 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
48 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
49 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
50 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
51 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
52 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
53 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
54 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
55 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
56 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
57 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
58 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
64 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
65 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
66 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
69 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
70 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
71 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
72 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
73 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
74 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
80 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
82 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 0
Rhizosphere 98.05
Stem 0
Stem Tuber 0
Unclassified 1.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10019876 3300003320 Bacteria 6087
2 rootH1_10075784 3300003323 Bacteria 2739
3 Ga0070714_100321914 3300005435 Bacteria 1446
4 Ga0070713_100158466 3300005436 Unclassified 2019
5 Ga0070686_100022684 3300005544 Unclassified 3743
6 Ga0068857_100054229 3300005577 Bacteria 3557
7 Ga0068857_100112914 3300005577 Bacteria 2443
8 Ga0068856_100000211 3300005614 Bacteria 63015
9 Ga0070702_100055235 3300005615 Bacteria 2289
10 Ga0068859_100010527 3300005617 Bacteria 9308
11 Ga0068863_100037746 3300005841 Bacteria 4597
12 Ga0068862_100611605 3300005844 Bacteria 1047
13 Ga0070715_10046507 3300006163 Bacteria 1845
14 Ga0097620_100010527 3300006931 Bacteria 9308
15 Ga0105240_10014331 3300009093 Bacteria 10829
16 Ga0105245_10195350 3300009098 Bacteria 1941
17 Ga0105247_10412176 3300009101 Unclassified 965
18 Ga0105238_10038127 3300009551 Bacteria 4882
19 Ga0105238_10208255 3300009551 Bacteria 1931
20 Ga0207695_10230390 3300025913 Bacteria 1757
21 Ga0207695_10254247 3300025913 Unclassified 1656
22 Ga0207694_10003518 3300025924 Bacteria 12431
23 Ga0207667_10024961 3300025949 Bacteria 6553
24 Ga0207702_10002640 3300026078 Bacteria 16839
25 Ga0207702_10063538 3300026078 Bacteria 3157
26 Ga0207641_10086040 3300026088 Bacteria 2740
27 Ga0207674_10049705 3300026116 Bacteria 4287
28 Ga0268265_10712255 3300028380 Unclassified 971
29 Ga0265337_1000036 3300028556 Bacteria 58197
30 Ga0265337_1000774 3300028556 Bacteria 16879
31 Ga0265337_1003794 3300028556 Bacteria 6440
32 Ga0265337_1009704 3300028556 Bacteria 3420
33 Ga0265337_1010477 3300028556 Bacteria 3245
34 Ga0265337_1055611 3300028556 Unclassified 1105
35 Ga0265337_1064264 3300028556 Unclassified 1013
36 Ga0265326_10006399 3300028558 Bacteria 3663
37 Ga0265326_10013506 3300028558 Bacteria 2388
38 Ga0265326_10024556 3300028558 Bacteria 1720
39 Ga0265319_1000019 3300028563 Bacteria 154537
40 Ga0265319_1009200 3300028563 Bacteria 4233
41 Ga0265319_1072553 3300028563 Bacteria 1102
42 Ga0265323_10001439 3300028653 Bacteria 11698
43 Ga0265323_10006091 3300028653 Bacteria 5090
44 Ga0265323_10036552 3300028653 Bacteria 1804
45 Ga0265323_10038340 3300028653 Bacteria 1752
46 Ga0265322_10045560 3300028654 Bacteria 1248
47 Ga0265336_10001074 3300028666 Bacteria 13279
48 Ga0265336_10019844 3300028666 Bacteria 2165
49 Ga0265336_10021297 3300028666 Bacteria 2073
50 Ga0265336_10028166 3300028666 Bacteria 1756
51 Ga0265336_10045576 3300028666 Bacteria 1333
52 Ga0265338_10000129 3300028800 Bacteria 138608
53 Ga0265338_10000593 3300028800 Bacteria 63891
54 Ga0265338_10000834 3300028800 Bacteria 51995
55 Ga0265338_10001094 3300028800 Bacteria 45068
56 Ga0265338_10001418 3300028800 Bacteria 39001
57 Ga0265338_10001689 3300028800 Bacteria 35059
58 Ga0265338_10004656 3300028800 Bacteria 18429
59 Ga0265338_10005377 3300028800 Bacteria 16734
60 Ga0265338_10008372 3300028800 Bacteria 12566
61 Ga0265338_10008501 3300028800 Bacteria 12450
62 Ga0265338_10011960 3300028800 Bacteria 9944
63 Ga0265338_10020307 3300028800 Bacteria 6999
64 Ga0265338_10022827 3300028800 Bacteria 6457
65 Ga0265338_10034387 3300028800 Bacteria 4900
66 Ga0265338_10035736 3300028800 Bacteria 4767
67 Ga0265338_10056004 3300028800 Bacteria 3501
68 Ga0265338_10122982 3300028800 Bacteria 2064
69 Ga0265324_10012770 3300029957 Bacteria 3156
70 Ga0265324_10022445 3300029957 Bacteria 2255
71 Ga0265324_10046050 3300029957 Unclassified 1501
72 Ga0265324_10046734 3300029957 Bacteria 1489
73 Ga0265328_10006716 3300031239 Bacteria 4845
74 Ga0265320_10001037 3300031240 Bacteria 20637
75 Ga0265320_10004500 3300031240 Bacteria 9124
76 Ga0265320_10019515 3300031240 Bacteria 3704
77 Ga0265320_10026767 3300031240 Bacteria 3014
78 Ga0265320_10052831 3300031240 Bacteria 1965
79 Ga0265325_10014207 3300031241 Bacteria 4507
80 Ga0265325_10036091 3300031241 Bacteria 2621
81 Ga0265325_10091141 3300031241 Bacteria 1503
82 Ga0265329_10002590 3300031242 Bacteria 8158
83 Ga0265340_10005220 3300031247 Bacteria 7211
84 Ga0265340_10014640 3300031247 Bacteria 4091
85 Ga0265339_10002641 3300031249 Bacteria 12778
86 Ga0265339_10049203 3300031249 Bacteria 2310
87 Ga0265327_10006883 3300031251 Bacteria 8943
88 Ga0265327_10033732 3300031251 Bacteria 2848
89 Ga0265327_10085231 3300031251 Bacteria 1551
90 Ga0265316_10002751 3300031344 Bacteria 18013
91 Ga0265316_10018450 3300031344 Bacteria 5994
92 Ga0265316_10024926 3300031344 Bacteria 5000
93 Ga0265316_10045680 3300031344 Bacteria 3475
94 Ga0265316_10064141 3300031344 Bacteria 2846
95 Ga0265316_10092212 3300031344 Bacteria 2310
96 Ga0265316_10113394 3300031344 Unclassified 2051
97 Ga0265316_10183025 3300031344 Bacteria 1559
98 Ga0265316_10268685 3300031344 Unclassified 1249
99 Ga0265313_10002888 3300031595 Bacteria 14389
100 Ga0265313_10003159 3300031595 Bacteria 13599
101 Ga0265314_10001317 3300031711 Bacteria 28131
102 Ga0265314_10016036 3300031711 Bacteria 5932
103 Ga0265314_10253365 3300031711 Bacteria 1009
104 Ga0265342_10041127 3300031712 Bacteria 2801
105 Ga0265342_10106437 3300031712 Bacteria 1592
106 Ga0373930_0003343 3300034816 Bacteria 2537
107 Ga0373926_0069194 3300035083 Unclassified 1295
108 Ga0373928_0000434 3300035084 Bacteria 8324
109 Ga0373929_0000709 3300035085 Bacteria 6461
110 Ga0373944_0000471 3300035089 Bacteria 9348
111 Ga0373949_0001831 3300035090 Bacteria 5796
112 Ga0373951_0025203 3300035091 Bacteria 1380
113 Ga0373932_0000006 3300035112 Bacteria 208547
114 Ga0373945_0021006 3300035116 Bacteria 2240
115 Ga0373945_0038997 3300035116 Bacteria 1711
116 Ga0373956_0101562 3300035119 Bacteria 1334
117 Ga0373957_0101563 3300035120 Unclassified 1152
118 Ga0373957_0170752 3300035120 Unclassified 899
119 Ga0373943_0013543 3300035170 Bacteria 3684
120 Ga0373931_0000009 3300035691 Bacteria 349854
121 Ga0373935_0170291 3300035692 Bacteria 1489
122 Ga0373927_0078933 3300035695 Unclassified 2132
123 Ga0373933_0324506 3300035724 Unclassified 998
124 Ga0373937_0074024 3300036401 Bacteria 3142
125 Ga0373937_0129849 3300036401 Bacteria 2353
126 Ga0373937_0139223 3300036401 Unclassified 2270
127 Ga0373925_0000301 3300037068 Bacteria 51799
128 Ga0373925_0007483 3300037068 Bacteria 7967
129 Ga0451577_0256162 3300042876 Bacteria 1584
130 Ga0453684_0000192 3300044712 Bacteria 266757
131 Ga0453684_0001999 3300044712 Bacteria 52205
132 Ga0495629_0350839 3300046459 Unclassified 1006
133 Ga0495608_0089051 3300046511 Bacteria 1998
134 Ga0495618_0022942 3300046514 Bacteria 3855
135 Ga0495630_0177821 3300046517 Bacteria 1622
136 Ga0495640_0126257 3300046533 Bacteria 1659
137 Ga0495586_0001244 3300046535 Bacteria 14299
138 Ga0495634_0084025 3300046642 Bacteria 2077
139 Ga0495634_0258702 3300046642 Bacteria 1063
140 Ga0495635_0175543 3300046663 Bacteria 1457
141 Ga0495635_0306547 3300046663 Unclassified 1064
142 Ga0495613_0280336 3300046689 Bacteria 1158
143 Ga0495680_0126860 3300047322 Bacteria 1878
144 Ga0495675_0322564 3300047444 Bacteria 913
145 Ga0501031_0000091 3300049568 Bacteria 48610
146 Ga0501032_0185390 3300049569 Bacteria 1361
147 Ga0501033_0021218 3300049570 Bacteria 4900
148 Ga0501043_0512501 3300049579 Unclassified 895
149 Ga0501080_0075822 3300049742 Bacteria 3128
150 Ga0501035_0028462 3300049822 Bacteria 5099
151 Ga0501035_0118970 3300049822 Bacteria 2311
152 Ga0501044_0000810 3300049823 Bacteria 37615
153 Ga0501044_0423435 3300049823 Unclassified 1241
154 Ga0500650_0004562 3300053098 Bacteria 5026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009101 Ga0105247_10412176 Ga0105247_104121761 247
2 3300044712 Ga0453684_0000192 Ga0453684_0000192_235204_235953 249
3 3300028800 Ga0265338_10000129 Ga0265338_10000129101 254
4 3300046517 Ga0495630_0177821 Ga0495630_0177821_60_824 254
5 3300005615 Ga0070702_100055235 Ga0070702_1000552354 255
6 3300044712 Ga0453684_0001999 Ga0453684_0001999_26559_27368 268
7 3300009093 Ga0105240_10014331 Ga0105240_100143316 270
8 3300025913 Ga0207695_10254247 Ga0207695_102542472 270
9 3300028558 Ga0265326_10006399 Ga0265326_100063993 270
10 3300035083 Ga0373926_0069194 Ga0373926_0069194_197_1009 270
11 3300035116 Ga0373945_0038997 Ga0373945_0038997_750_1562 270
12 3300035692 Ga0373935_0170291 Ga0373935_0170291_318_1130 270
13 3300035695 Ga0373927_0078933 Ga0373927_0078933_961_1773 270
14 3300037068 Ga0373925_0007483 Ga0373925_0007483_4679_5491 270
15 3300003323 rootH1_10075784 rootH1_100757843 272
16 3300005436 Ga0070713_100158466 Ga0070713_1001584662 272
17 3300005544 Ga0070686_100022684 Ga0070686_1000226846 272
18 3300036401 Ga0373937_0139223 Ga0373937_0139223_1351_2172 272
19 3300005577 Ga0068857_100112914 Ga0068857_1001129142 274
20 3300005614 Ga0068856_100000211 Ga0068856_10000021148 274
21 3300005617 Ga0068859_100010527 Ga0068859_1000105278 274
22 3300006163 Ga0070715_10046507 Ga0070715_100465072 274
23 3300006931 Ga0097620_100010527 Ga0097620_1000105278 274
24 3300025949 Ga0207667_10024961 Ga0207667_100249618 274
25 3300026078 Ga0207702_10002640 Ga0207702_100026402 274
26 3300028558 Ga0265326_10013506 Ga0265326_100135063 274
27 3300028558 Ga0265326_10024556 Ga0265326_100245562 274
28 3300028563 Ga0265319_1009200 Ga0265319_10092002 274
29 3300028653 Ga0265323_10006091 Ga0265323_100060913 274
30 3300028666 Ga0265336_10028166 Ga0265336_100281661 274
31 3300028800 Ga0265338_10004656 Ga0265338_100046563 274
32 3300028800 Ga0265338_10008372 Ga0265338_100083728 274
33 3300028800 Ga0265338_10011960 Ga0265338_100119608 274
34 3300028800 Ga0265338_10056004 Ga0265338_100560043 274
35 3300029957 Ga0265324_10012770 Ga0265324_100127701 274
36 3300029957 Ga0265324_10022445 Ga0265324_100224452 274
37 3300029957 Ga0265324_10046734 Ga0265324_100467342 274
38 3300031240 Ga0265320_10019515 Ga0265320_100195152 274
39 3300031241 Ga0265325_10014207 Ga0265325_100142071 274
40 3300031241 Ga0265325_10036091 Ga0265325_100360912 274
41 3300031241 Ga0265325_10091141 Ga0265325_100911411 274
42 3300031249 Ga0265339_10002641 Ga0265339_100026414 274
43 3300031251 Ga0265327_10006883 Ga0265327_100068831 274
44 3300031251 Ga0265327_10033732 Ga0265327_100337323 274
45 3300031251 Ga0265327_10085231 Ga0265327_100852312 274
46 3300031344 Ga0265316_10002751 Ga0265316_1000275110 274
47 3300031344 Ga0265316_10018450 Ga0265316_100184501 274
48 3300031344 Ga0265316_10183025 Ga0265316_101830251 274
49 3300031595 Ga0265313_10002888 Ga0265313_100028884 274
50 3300031711 Ga0265314_10253365 Ga0265314_102533651 274
51 3300034816 Ga0373930_0003343 Ga0373930_0003343_1269_2093 274
52 3300035084 Ga0373928_0000434 Ga0373928_0000434_492_1316 274
53 3300035085 Ga0373929_0000709 Ga0373929_0000709_3814_4638 274
54 3300035089 Ga0373944_0000471 Ga0373944_0000471_5806_6630 274
55 3300035090 Ga0373949_0001831 Ga0373949_0001831_76_900 274
56 3300035091 Ga0373951_0025203 Ga0373951_0025203_117_941 274
57 3300035112 Ga0373932_0000006 Ga0373932_0000006_75349_76173 274
58 3300035116 Ga0373945_0021006 Ga0373945_0021006_211_1035 274
59 3300035120 Ga0373957_0170752 Ga0373957_0170752_31_855 274
60 3300035170 Ga0373943_0013543 Ga0373943_0013543_2562_3386 274
61 3300035691 Ga0373931_0000009 Ga0373931_0000009_73664_74488 274
62 3300036401 Ga0373937_0129849 Ga0373937_0129849_1025_1849 274
63 3300037068 Ga0373925_0000301 Ga0373925_0000301_27049_27873 274
64 3300046511 Ga0495608_0089051 Ga0495608_0089051_531_1355 274
65 3300046533 Ga0495640_0126257 Ga0495640_0126257_124_948 274
66 3300046642 Ga0495634_0258702 Ga0495634_0258702_159_983 274
67 3300046663 Ga0495635_0175543 Ga0495635_0175543_65_889 274
68 3300046689 Ga0495613_0280336 Ga0495613_0280336_170_994 274
69 3300047444 Ga0495675_0322564 Ga0495675_0322564_75_899 274
70 3300049823 Ga0501044_0423435 Ga0501044_0423435_250_1074 274
71 3300003320 rootH2_10019876 rootH2_100198762 275
72 3300005435 Ga0070714_100321914 Ga0070714_1003219142 275
73 3300005577 Ga0068857_100054229 Ga0068857_1000542293 275
74 3300005841 Ga0068863_100037746 Ga0068863_1000377462 275
75 3300005844 Ga0068862_100611605 Ga0068862_1006116051 275
76 3300009098 Ga0105245_10195350 Ga0105245_101953502 275
77 3300009551 Ga0105238_10038127 Ga0105238_100381273 275
78 3300009551 Ga0105238_10208255 Ga0105238_102082552 275
79 3300025913 Ga0207695_10230390 Ga0207695_102303902 275
80 3300025924 Ga0207694_10003518 Ga0207694_100035182 275
81 3300026078 Ga0207702_10063538 Ga0207702_100635385 275
82 3300026088 Ga0207641_10086040 Ga0207641_100860402 275
83 3300026116 Ga0207674_10049705 Ga0207674_100497053 275
84 3300028380 Ga0268265_10712255 Ga0268265_107122551 275
85 3300028556 Ga0265337_1000036 Ga0265337_100003655 275
86 3300028556 Ga0265337_1000774 Ga0265337_10007747 275
87 3300028556 Ga0265337_1003794 Ga0265337_10037943 275
88 3300028556 Ga0265337_1009704 Ga0265337_10097043 275
89 3300028556 Ga0265337_1010477 Ga0265337_10104773 275
90 3300028556 Ga0265337_1055611 Ga0265337_10556111 275
91 3300028556 Ga0265337_1064264 Ga0265337_10642642 275
92 3300028563 Ga0265319_1000019 Ga0265319_100001916 275
93 3300028563 Ga0265319_1072553 Ga0265319_10725531 275
94 3300028653 Ga0265323_10001439 Ga0265323_100014397 275
95 3300028653 Ga0265323_10036552 Ga0265323_100365522 275
96 3300028653 Ga0265323_10038340 Ga0265323_100383402 275
97 3300028654 Ga0265322_10045560 Ga0265322_100455602 275
98 3300028666 Ga0265336_10001074 Ga0265336_100010743 275
99 3300028666 Ga0265336_10019844 Ga0265336_100198442 275
100 3300028666 Ga0265336_10021297 Ga0265336_100212972 275
101 3300028666 Ga0265336_10045576 Ga0265336_100455762 275
102 3300028800 Ga0265338_10000593 Ga0265338_1000059340 275
103 3300028800 Ga0265338_10000834 Ga0265338_1000083430 275
104 3300028800 Ga0265338_10001094 Ga0265338_1000109411 275
105 3300028800 Ga0265338_10001418 Ga0265338_100014182 275
106 3300028800 Ga0265338_10001689 Ga0265338_1000168918 275
107 3300028800 Ga0265338_10005377 Ga0265338_100053778 275
108 3300028800 Ga0265338_10008501 Ga0265338_100085015 275
109 3300028800 Ga0265338_10020307 Ga0265338_100203072 275
110 3300028800 Ga0265338_10022827 Ga0265338_100228278 275
111 3300028800 Ga0265338_10034387 Ga0265338_100343873 275
112 3300028800 Ga0265338_10035736 Ga0265338_100357362 275
113 3300028800 Ga0265338_10122982 Ga0265338_101229822 275
114 3300029957 Ga0265324_10046050 Ga0265324_100460501 275
115 3300031239 Ga0265328_10006716 Ga0265328_100067166 275
116 3300031240 Ga0265320_10001037 Ga0265320_100010374 275
117 3300031240 Ga0265320_10004500 Ga0265320_100045006 275
118 3300031240 Ga0265320_10026767 Ga0265320_100267673 275
119 3300031240 Ga0265320_10052831 Ga0265320_100528313 275
120 3300031242 Ga0265329_10002590 Ga0265329_100025909 275
121 3300031247 Ga0265340_10005220 Ga0265340_100052202 275
122 3300031247 Ga0265340_10014640 Ga0265340_100146402 275
123 3300031249 Ga0265339_10049203 Ga0265339_100492031 275
124 3300031344 Ga0265316_10024926 Ga0265316_100249263 275
125 3300031344 Ga0265316_10045680 Ga0265316_100456802 275
126 3300031344 Ga0265316_10064141 Ga0265316_100641412 275
127 3300031344 Ga0265316_10092212 Ga0265316_100922123 275
128 3300031344 Ga0265316_10113394 Ga0265316_101133942 275
129 3300031344 Ga0265316_10268685 Ga0265316_102686852 275
130 3300031595 Ga0265313_10003159 Ga0265313_1000315911 275
131 3300031711 Ga0265314_10001317 Ga0265314_1000131720 275
132 3300031711 Ga0265314_10016036 Ga0265314_100160364 275
133 3300031712 Ga0265342_10041127 Ga0265342_100411273 275
134 3300031712 Ga0265342_10106437 Ga0265342_101064372 275
135 3300035119 Ga0373956_0101562 Ga0373956_0101562_61_888 275
136 3300035120 Ga0373957_0101563 Ga0373957_0101563_57_884 275
137 3300035724 Ga0373933_0324506 Ga0373933_0324506_93_920 275
138 3300036401 Ga0373937_0074024 Ga0373937_0074024_599_1426 275
139 3300042876 Ga0451577_0256162 Ga0451577_0256162_380_1207 275
140 3300046459 Ga0495629_0350839 Ga0495629_0350839_86_913 275
141 3300046514 Ga0495618_0022942 Ga0495618_0022942_77_904 275
142 3300046535 Ga0495586_0001244 Ga0495586_0001244_46_873 275
143 3300046642 Ga0495634_0084025 Ga0495634_0084025_72_899 275
144 3300046663 Ga0495635_0306547 Ga0495635_0306547_145_972 275
145 3300047322 Ga0495680_0126860 Ga0495680_0126860_322_1149 275
146 3300049568 Ga0501031_0000091 Ga0501031_0000091_32152_32979 275
147 3300049569 Ga0501032_0185390 Ga0501032_0185390_434_1261 275
148 3300049570 Ga0501033_0021218 Ga0501033_0021218_2604_3431 275
149 3300049579 Ga0501043_0512501 Ga0501043_0512501_27_854 275
150 3300049742 Ga0501080_0075822 Ga0501080_0075822_2283_3110 275
151 3300049822 Ga0501035_0028462 Ga0501035_0028462_80_907 275
152 3300049822 Ga0501035_0118970 Ga0501035_0118970_981_1808 275
153 3300049823 Ga0501044_0000810 Ga0501044_0000810_15911_16738 275
154 3300053098 Ga0500650_0004562 Ga0500650_0004562_4136_4963 275

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b2y-assembly2.cif.gz_B crystal structure of a putative metallopeptidase (sden_2526) from shewanella denitrificans os217 at 1.74 a resolution 0.8435 21 263
3b2y-assembly1.cif.gz_A crystal structure of a putative metallopeptidase (sden_2526) from shewanella denitrificans os217 at 1.74 a resolution 0.8412 21 263
2qvp-assembly1.cif.gz_A crystal structure of a putative metallopeptidase (sama_0725) from shewanella amazonensis sb2b at 2.00 a resolution 0.8274 21 263
3ieh-assembly1.cif.gz_A crystal structure of putative metallopeptidase (yp_001051774.1) from shewanella baltica os155 at 2.45 a resolution 0.8197 21 263
4oko-assembly4.cif.gz_D crystal structure of francisella tularensis rep34 (rapid encystment phenotype protein 34 kda) 0.8071 14 267
ID Description Score Start End Superfamily
3b2yB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8271 21 264 3.40.630.10
4okoC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8066 14 266 3.40.630.10
af_A0A0P0WSN8_58_197_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7832 17 143 3.40.630.10
af_I1NH52_71_347_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7572 17 263 3.40.630.10
af_E7F254_893_1182_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7547 20 266 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A2V5QJH1-F1-model_v4 Peptidase M14 0.9728 73 216 GO:0016788
GO:0046872
AF-A0A6N6QA65-F1-model_v4 M14 family metallocarboxypeptidase 0.9726 39 275 GO:0004180
GO:0016788
GO:0046872
AF-A0A290QIM9-F1-model_v4 Peptidase M14 0.965 17 275 GO:0016788
GO:0046872
AF-A0A6N6QA65-F1-model_v4 M14 family metallocarboxypeptidase 0.9646 39 275 GO:0004180
GO:0016788
GO:0046872
AF-A0A4Q2XZ68-F1-model_v4 Peptidase M14 carboxypeptidase A domain-containing protein 0.9642 19 275 GO:0016788
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.36 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map