F219648

General Info

Members Datasets Scaffolds Average Seq Length
154 106 152 146

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_12474672|Ga0157378_124746721
Length 151
Sequence MEKVSIYLNFMGNTEEAFNYYKSVFKTDFSAPIYRMGDGPSQPGMLQISDTDKKKVMHVALPIIGGTEIMGTDMLESMGHKLMVGNNTTISLTLDSKEKADTIYKALAEGGKEKECVAPHDEFWGYWGVCLDRFGIRWMFNVPNPAMQQNK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
78 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
79 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 0.65
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 1.95
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 2.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13300874 2162886012 Unclassified 855
2 rootL2_10031572 3300003322 Bacteria 7900
3 Ga0065712_10180945 3300005290 Unclassified 1193
4 Ga0065712_10397374 3300005290 Bacteria 735
5 Ga0065715_10294026 3300005293 Bacteria 1056
6 Ga0070658_10018516 3300005327 Bacteria 5575
7 Ga0070683_100106490 3300005329 Unclassified 2643
8 Ga0068869_101277697 3300005334 Bacteria 647
9 Ga0070682_101134215 3300005337 Unclassified 656
10 Ga0070691_10010746 3300005341 Bacteria 4179
11 Ga0070691_10312046 3300005341 Unclassified 862
12 Ga0070661_100652842 3300005344 Unclassified 854
13 Ga0070669_100070609 3300005353 Bacteria 2582
14 Ga0070667_100188532 3300005367 Unclassified 1826
15 Ga0070713_100701580 3300005436 Bacteria 966
16 Ga0070684_100067421 3300005535 Bacteria 3143
17 Ga0070684_100105541 3300005535 Unclassified 2521
18 Ga0068853_100006706 3300005539 Bacteria 9175
19 Ga0070672_100184354 3300005543 Bacteria 1740
20 Ga0070686_101382552 3300005544 Unclassified 590
21 Ga0068855_100005188 3300005563 Bacteria 15890
22 Ga0068857_100057215 3300005577 Bacteria 3461
23 Ga0068856_100030215 3300005614 Bacteria 5297
24 Ga0068856_100065835 3300005614 Unclassified 3581
25 Ga0068856_100218022 3300005614 Bacteria 1923
26 Ga0068856_100292372 3300005614 Bacteria 1646
27 Ga0068852_100177175 3300005616 Bacteria 2002
28 Ga0068852_100921479 3300005616 Bacteria 891
29 Ga0068852_101075010 3300005616 Bacteria 824
30 Ga0068852_101249793 3300005616 Bacteria 764
31 Ga0068859_100436193 3300005617 Unclassified 1406
32 Ga0068859_102606023 3300005617 Unclassified 556
33 Ga0068864_100291255 3300005618 Unclassified 1526
34 Ga0068851_10066493 3300005834 Bacteria 1857
35 Ga0068863_100345872 3300005841 Unclassified 1447
36 Ga0068860_100895120 3300005843 Bacteria 903
37 Ga0068860_102280611 3300005843 Bacteria 562
38 Ga0070715_10712910 3300006163 Unclassified 600
39 Ga0070712_100322382 3300006175 Unclassified 1257
40 Ga0070712_101243006 3300006175 Unclassified 648
41 Ga0097620_100436186 3300006931 Unclassified 1406
42 Ga0097620_102603818 3300006931 Unclassified 556
43 Ga0105240_10021505 3300009093 Bacteria 8578
44 Ga0105240_10286430 3300009093 Unclassified 1890
45 Ga0111539_10182470 3300009094 Bacteria 2451
46 Ga0105245_10251908 3300009098 Bacteria 1716
47 Ga0105241_10031439 3300009174 Bacteria 3975
48 Ga0105241_10882355 3300009174 Unclassified 829
49 Ga0105242_10613023 3300009176 Unclassified 1053
50 Ga0105242_11909384 3300009176 Bacteria 634
51 Ga0105248_10119908 3300009177 Unclassified 2967
52 Ga0105237_10002152 3300009545 Bacteria 24808
53 Ga0105238_10173507 3300009551 Unclassified 2132
54 Ga0105238_10219002 3300009551 Bacteria 1879
55 Ga0105238_10406927 3300009551 Unclassified 1354
56 Ga0105238_11362220 3300009551 Unclassified 736
57 Ga0105249_10336815 3300009553 Bacteria 1524
58 Ga0105239_10021618 3300010375 Bacteria 7094
59 Ga0105239_10038059 3300010375 Bacteria 5270
60 Ga0157373_10648668 3300013100 Unclassified 771
61 Ga0157370_10103984 3300013104 Bacteria 2658
62 Ga0157370_11317870 3300013104 Bacteria 650
63 Ga0157369_10782497 3300013105 Bacteria 981
64 Ga0157374_11251185 3300013296 Bacteria 764
65 Ga0157378_12474672 3300013297 Unclassified 571
66 Ga0157372_10006150 3300013307 Bacteria 12759
67 Ga0157372_10116871 3300013307 Unclassified 3058
68 Ga0157372_10158965 3300013307 Bacteria 2611
69 Ga0157372_10173086 3300013307 Bacteria 2498
70 Ga0157372_10312600 3300013307 Unclassified 1829
71 Ga0157372_10438269 3300013307 Bacteria 1523
72 Ga0157372_11344744 3300013307 Unclassified 824
73 Ga0157372_11601135 3300013307 Bacteria 750
74 Ga0157375_10037480 3300013308 Bacteria 4647
75 Ga0157379_10395413 3300014968 Bacteria 1270
76 Ga0157376_12615537 3300014969 Bacteria 544
77 Ga0224712_10182330 3300022467 Bacteria 946
78 Ga0207656_10045414 3300025321 Bacteria 1880
79 Ga0207642_10702172 3300025899 Unclassified 637
80 Ga0207699_11081185 3300025906 Unclassified 594
81 Ga0207705_10009201 3300025909 Bacteria 7193
82 Ga0207654_10095312 3300025911 Bacteria 1823
83 Ga0207695_10000236 3300025913 Bacteria 146419
84 Ga0207695_10005402 3300025913 Bacteria 16967
85 Ga0207695_10044591 3300025913 Bacteria 4715
86 Ga0207695_10742673 3300025913 Unclassified 862
87 Ga0207671_10143559 3300025914 Bacteria 1841
88 Ga0207681_10128825 3300025923 Bacteria 1868
89 Ga0207694_10159290 3300025924 Bacteria 1823
90 Ga0207694_10167437 3300025924 Unclassified 1778
91 Ga0207694_10407655 3300025924 Unclassified 1131
92 Ga0207694_11156188 3300025924 Unclassified 655
93 Ga0207650_10662339 3300025925 Bacteria 880
94 Ga0207706_10256231 3300025933 Bacteria 1528
95 Ga0207691_10811475 3300025940 Bacteria 786
96 Ga0207711_10529011 3300025941 Unclassified 1099
97 Ga0207689_10944960 3300025942 Bacteria 727
98 Ga0207661_10090769 3300025944 Bacteria 2544
99 Ga0207661_10457825 3300025944 Unclassified 1162
100 Ga0207703_12251593 3300026035 Bacteria 521
101 Ga0207639_10057547 3300026041 Bacteria 2985
102 Ga0207702_10038511 3300026078 Bacteria 4004
103 Ga0207702_10048358 3300026078 Bacteria 3587
104 Ga0207702_10547445 3300026078 Bacteria 1132
105 Ga0207702_11211655 3300026078 Bacteria 749
106 Ga0207641_10339183 3300026088 Unclassified 1430
107 Ga0207676_10141841 3300026095 Unclassified 2058
108 Ga0207674_10304695 3300026116 Bacteria 1542
109 Ga0207698_10364378 3300026142 Bacteria 1370
110 Ga0207698_11707012 3300026142 Bacteria 645
111 Ga0268264_11280944 3300028381 Bacteria 743
112 Ga0265332_10327967 3300031238 Bacteria 632
113 Ga0265327_10004786 3300031251 Bacteria 11772
114 Ga0265327_10022918 3300031251 Bacteria 3714
115 Ga0307509_10993666 3300031507 Unclassified 506
116 Ga0373960_0092524 3300035121 Unclassified 969
117 Ga0373931_0008571 3300035691 Unclassified 4854
118 Ga0373937_0864956 3300036401 Unclassified 853
119 Ga0373925_0483673 3300037068 Unclassified 1016
120 Ga0395901_0000135 3300038443 Bacteria 95547
121 Ga0451843_1463654 3300041509 Unclassified 692
122 Ga0451577_0046342 3300042876 Bacteria 3891
123 Ga0451577_0051649 3300042876 Unclassified 3671
124 Ga0453683_0674594 3300044673 Bacteria 676
125 Ga0453684_0039375 3300044712 Bacteria 6443
126 Ga0453684_0090203 3300044712 Bacteria 3788
127 Ga0453684_0117021 3300044712 Bacteria 3226
128 Ga0453684_0758485 3300044712 Bacteria 1050
129 Ga0451576_0005589 3300045051 Bacteria 15708
130 Ga0451576_0029798 3300045051 Bacteria 5838
131 Ga0451576_0103086 3300045051 Unclassified 2968
132 Ga0451576_0250239 3300045051 Bacteria 1852
133 Ga0451576_0956198 3300045051 Unclassified 898
134 Ga0495664_0291379 3300046477 Bacteria 986
135 Ga0495585_0391773 3300046492 Bacteria 670
136 Ga0495640_0241028 3300046533 Bacteria 1135
137 Ga0495645_0627086 3300046543 Bacteria 659
138 Ga0495634_0024979 3300046642 Bacteria 4188
139 Ga0495661_0407589 3300046665 Bacteria 660
140 Ga0495658_0030294 3300046683 Unclassified 2937
141 Ga0495674_0718452 3300047319 Bacteria 783
142 Ga0496104_0640646 3300048907 Bacteria 972
143 Ga0496112_0140417 3300048915 Unclassified 2385
144 Ga0496113_0098961 3300048916 Unclassified 2258
145 Ga0501034_0000373 3300049571 Bacteria 76337
146 Ga0501040_0480619 3300049576 Bacteria 895
147 Ga0501043_0194775 3300049579 Unclassified 1575
148 Ga0501047_0991644 3300049581 Bacteria 653
149 Ga0501242_043285 3300049674 Viruses 642
150 Ga0501044_0676655 3300049823 Bacteria 919
151 nmdc:mga08y16_360984_c1 3300050511 Bacteria 1491
152 Ga0500652_042878 3300053131 Bacteria 1827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025925 Ga0207650_10662339 Ga0207650_106623391 133
2 3300036401 Ga0373937_0864956 Ga0373937_0864956_321_758 133
3 iso_pu_bacteria 2818991460 2819678467 135
4 3300005616 Ga0068852_101249793 Ga0068852_1012497931 139
5 3300006163 Ga0070715_10712910 Ga0070715_107129101 139
6 3300013105 Ga0157369_10782497 Ga0157369_107824971 139
7 3300013307 Ga0157372_10158965 Ga0157372_101589654 139
8 3300026142 Ga0207698_11707012 Ga0207698_117070121 139
9 iso_pu_bacteria 2923525760 2923529718 140
10 3300005539 Ga0068853_100006706 Ga0068853_10000670614 142
11 3300005616 Ga0068852_100921479 Ga0068852_1009214792 142
12 3300005843 Ga0068860_100895120 Ga0068860_1008951202 142
13 3300009174 Ga0105241_10882355 Ga0105241_108823552 142
14 3300009545 Ga0105237_10002152 Ga0105237_1000215210 142
15 3300009551 Ga0105238_10406927 Ga0105238_104069272 142
16 3300009551 Ga0105238_11362220 Ga0105238_113622202 142
17 3300010375 Ga0105239_10038059 Ga0105239_1003805910 142
18 3300013296 Ga0157374_11251185 Ga0157374_112511852 142
19 3300013307 Ga0157372_10116871 Ga0157372_101168713 142
20 3300013307 Ga0157372_10312600 Ga0157372_103126002 142
21 3300014969 Ga0157376_12615537 Ga0157376_126155371 142
22 3300025913 Ga0207695_10044591 Ga0207695_100445916 142
23 3300025924 Ga0207694_10407655 Ga0207694_104076552 142
24 3300025924 Ga0207694_11156188 Ga0207694_111561882 142
25 3300026035 Ga0207703_12251593 Ga0207703_122515931 142
26 3300026041 Ga0207639_10057547 Ga0207639_100575471 142
27 3300026078 Ga0207702_11211655 Ga0207702_112116552 142
28 3300028381 Ga0268264_11280944 Ga0268264_112809442 142
29 3300031251 Ga0265327_10022918 Ga0265327_100229187 142
30 3300003322 rootL2_10031572 rootL2_100315724 143
31 3300005341 Ga0070691_10010746 Ga0070691_100107461 143
32 3300005341 Ga0070691_10312046 Ga0070691_103120461 143
33 3300005535 Ga0070684_100067421 Ga0070684_1000674212 143
34 3300005563 Ga0068855_100005188 Ga0068855_1000051883 143
35 3300005614 Ga0068856_100030215 Ga0068856_1000302153 143
36 3300009093 Ga0105240_10286430 Ga0105240_102864302 143
37 3300010375 Ga0105239_10021618 Ga0105239_100216185 143
38 3300013100 Ga0157373_10648668 Ga0157373_106486682 143
39 3300013104 Ga0157370_10103984 Ga0157370_101039842 143
40 3300013307 Ga0157372_10006150 Ga0157372_100061505 143
41 3300013307 Ga0157372_11601135 Ga0157372_116011351 143
42 3300025899 Ga0207642_10702172 Ga0207642_107021721 143
43 3300025913 Ga0207695_10000236 Ga0207695_1000023697 143
44 3300025913 Ga0207695_10742673 Ga0207695_107426732 143
45 3300025944 Ga0207661_10090769 Ga0207661_100907691 143
46 3300026078 Ga0207702_10038511 Ga0207702_100385113 143
47 3300049576 Ga0501040_0480619 Ga0501040_0480619_65_499 143
48 3300049581 Ga0501047_0991644 Ga0501047_0991644_123_560 143
49 3300049674 Ga0501242_043285 Ga0501242_043285_33_467 143
50 3300053131 Ga0500652_042878 Ga0500652_042878_606_1040 143
51 2162886012 MBSR1b_contig_13300874 MBSR1b_0583.00007510 144
52 3300005290 Ga0065712_10180945 Ga0065712_101809452 144
53 3300005290 Ga0065712_10397374 Ga0065712_103973742 144
54 3300005293 Ga0065715_10294026 Ga0065715_102940261 144
55 3300005327 Ga0070658_10018516 Ga0070658_100185166 144
56 3300005329 Ga0070683_100106490 Ga0070683_1001064903 144
57 3300005334 Ga0068869_101277697 Ga0068869_1012776971 144
58 3300005337 Ga0070682_101134215 Ga0070682_1011342151 144
59 3300005344 Ga0070661_100652842 Ga0070661_1006528421 144
60 3300005353 Ga0070669_100070609 Ga0070669_1000706093 144
61 3300005367 Ga0070667_100188532 Ga0070667_1001885322 144
62 3300005436 Ga0070713_100701580 Ga0070713_1007015801 144
63 3300005535 Ga0070684_100105541 Ga0070684_1001055413 144
64 3300005543 Ga0070672_100184354 Ga0070672_1001843541 144
65 3300005544 Ga0070686_101382552 Ga0070686_1013825521 144
66 3300005577 Ga0068857_100057215 Ga0068857_1000572157 144
67 3300005614 Ga0068856_100065835 Ga0068856_1000658353 144
68 3300005614 Ga0068856_100218022 Ga0068856_1002180221 144
69 3300005614 Ga0068856_100292372 Ga0068856_1002923722 144
70 3300005616 Ga0068852_100177175 Ga0068852_1001771753 144
71 3300005616 Ga0068852_101075010 Ga0068852_1010750101 144
72 3300005617 Ga0068859_100436193 Ga0068859_1004361932 144
73 3300005617 Ga0068859_102606023 Ga0068859_1026060231 144
74 3300005618 Ga0068864_100291255 Ga0068864_1002912552 144
75 3300005834 Ga0068851_10066493 Ga0068851_100664931 144
76 3300005841 Ga0068863_100345872 Ga0068863_1003458722 144
77 3300005843 Ga0068860_102280611 Ga0068860_1022806111 144
78 3300006175 Ga0070712_100322382 Ga0070712_1003223822 144
79 3300006175 Ga0070712_101243006 Ga0070712_1012430061 144
80 3300006931 Ga0097620_100436186 Ga0097620_1004361862 144
81 3300006931 Ga0097620_102603818 Ga0097620_1026038181 144
82 3300009093 Ga0105240_10021505 Ga0105240_100215054 144
83 3300009094 Ga0111539_10182470 Ga0111539_101824704 144
84 3300009098 Ga0105245_10251908 Ga0105245_102519082 144
85 3300009174 Ga0105241_10031439 Ga0105241_100314392 144
86 3300009176 Ga0105242_10613023 Ga0105242_106130232 144
87 3300009176 Ga0105242_11909384 Ga0105242_119093841 144
88 3300009177 Ga0105248_10119908 Ga0105248_101199082 144
89 3300009551 Ga0105238_10173507 Ga0105238_101735073 144
90 3300009551 Ga0105238_10219002 Ga0105238_102190023 144
91 3300009553 Ga0105249_10336815 Ga0105249_103368151 144
92 3300013104 Ga0157370_11317870 Ga0157370_113178701 144
93 3300013297 Ga0157378_12474672 Ga0157378_124746721 144
94 3300013307 Ga0157372_10173086 Ga0157372_101730864 144
95 3300013307 Ga0157372_10438269 Ga0157372_104382692 144
96 3300013307 Ga0157372_11344744 Ga0157372_113447441 144
97 3300013308 Ga0157375_10037480 Ga0157375_100374802 144
98 3300014968 Ga0157379_10395413 Ga0157379_103954132 144
99 3300022467 Ga0224712_10182330 Ga0224712_101823303 144
100 3300025321 Ga0207656_10045414 Ga0207656_100454141 144
101 3300025906 Ga0207699_11081185 Ga0207699_110811851 144
102 3300025909 Ga0207705_10009201 Ga0207705_100092013 144
103 3300025911 Ga0207654_10095312 Ga0207654_100953122 144
104 3300025913 Ga0207695_10005402 Ga0207695_1000540214 144
105 3300025914 Ga0207671_10143559 Ga0207671_101435593 144
106 3300025923 Ga0207681_10128825 Ga0207681_101288253 144
107 3300025924 Ga0207694_10159290 Ga0207694_101592903 144
108 3300025924 Ga0207694_10167437 Ga0207694_101674372 144
109 3300025933 Ga0207706_10256231 Ga0207706_102562312 144
110 3300025940 Ga0207691_10811475 Ga0207691_108114752 144
111 3300025941 Ga0207711_10529011 Ga0207711_105290112 144
112 3300025942 Ga0207689_10944960 Ga0207689_109449601 144
113 3300025944 Ga0207661_10457825 Ga0207661_104578252 144
114 3300026078 Ga0207702_10048358 Ga0207702_100483583 144
115 3300026078 Ga0207702_10547445 Ga0207702_105474451 144
116 3300026088 Ga0207641_10339183 Ga0207641_103391832 144
117 3300026095 Ga0207676_10141841 Ga0207676_101418412 144
118 3300026116 Ga0207674_10304695 Ga0207674_103046953 144
119 3300026142 Ga0207698_10364378 Ga0207698_103643782 144
120 3300031238 Ga0265332_10327967 Ga0265332_103279671 144
121 3300031251 Ga0265327_10004786 Ga0265327_100047866 144
122 3300031507 Ga0307509_10993666 Ga0307509_109936661 144
123 3300035121 Ga0373960_0092524 Ga0373960_0092524_63_500 144
124 3300035691 Ga0373931_0008571 Ga0373931_0008571_3918_4355 144
125 3300037068 Ga0373925_0483673 Ga0373925_0483673_383_820 144
126 3300038443 Ga0395901_0000135 Ga0395901_0000135_68159_68674 144
127 3300041509 Ga0451843_1463654 Ga0451843_1463654_35_586 144
128 3300042876 Ga0451577_0046342 Ga0451577_0046342_437_874 144
129 3300042876 Ga0451577_0051649 Ga0451577_0051649_2054_2494 144
130 3300044673 Ga0453683_0674594 Ga0453683_0674594_173_616 144
131 3300044712 Ga0453684_0039375 Ga0453684_0039375_2988_3428 144
132 3300044712 Ga0453684_0090203 Ga0453684_0090203_253_693 144
133 3300044712 Ga0453684_0117021 Ga0453684_0117021_2042_2482 144
134 3300044712 Ga0453684_0758485 Ga0453684_0758485_168_605 144
135 3300045051 Ga0451576_0005589 Ga0451576_0005589_925_1362 144
136 3300045051 Ga0451576_0029798 Ga0451576_0029798_3429_3908 144
137 3300045051 Ga0451576_0103086 Ga0451576_0103086_1694_2134 144
138 3300045051 Ga0451576_0250239 Ga0451576_0250239_317_754 144
139 3300045051 Ga0451576_0956198 Ga0451576_0956198_20_457 144
140 3300046477 Ga0495664_0291379 Ga0495664_0291379_194_640 144
141 3300046492 Ga0495585_0391773 Ga0495585_0391773_196_639 144
142 3300046533 Ga0495640_0241028 Ga0495640_0241028_554_1000 144
143 3300046543 Ga0495645_0627086 Ga0495645_0627086_202_648 144
144 3300046642 Ga0495634_0024979 Ga0495634_0024979_2499_2945 144
145 3300046665 Ga0495661_0407589 Ga0495661_0407589_198_641 144
146 3300046683 Ga0495658_0030294 Ga0495658_0030294_1381_1860 144
147 3300047319 Ga0495674_0718452 Ga0495674_0718452_302_748 144
148 3300048907 Ga0496104_0640646 Ga0496104_0640646_68_505 144
149 3300048915 Ga0496112_0140417 Ga0496112_0140417_1451_1888 144
150 3300048916 Ga0496113_0098961 Ga0496113_0098961_193_630 144
151 3300049571 Ga0501034_0000373 Ga0501034_0000373_58425_58862 144
152 3300049579 Ga0501043_0194775 Ga0501043_0194775_108_548 144
153 3300049823 Ga0501044_0676655 Ga0501044_0676655_332_769 144
154 3300050511 nmdc:mga08y16_360984_c1 nmdc:mga08y16_360984_c1_555_992 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

2

140

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.9141 1 141
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8947 1 141
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8352 2 140
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.8234 2 140
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8234 2 140
ID Description Score Start End Superfamily
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9049 89 140 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9004 8 141 3.10.180.10
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8905 86 141 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8793 8 141 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8338 2 140 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2W2AEQ1-F1-model_v4 VOC family protein 0.9844 1 144
AF-A0A2W2AEQ1-F1-model_v4 VOC family protein 0.9777 1 144
AF-A0A257RL15-F1-model_v4 VOC family protein 0.9485 1 140
AF-A0A848UIG6-F1-model_v4 VOC family protein 0.9474 1 141
AF-A0A520H7M9-F1-model_v4 VOC family protein 0.9474 1 144

Feature Viewer

pLDDT pTM Quality
93.24 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map