F219487

General Info

Members Datasets Scaffolds Average Seq Length
154 98 308 114

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10186905|Ga0105245_101869052
Length 127
Sequence MENNEVDLAFQPEGQVDPNFRQRVEALVAQIPKGRVMTYGQLATLCGNARAARVVGGIAHFGDPNMPWQRVVNKKGGLASGYYGGRRGQKAALEAEGFEVSDDYTVDVDKLIWWPDGEPEGMQQGLF

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
73 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
74 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
87 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
88 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
92 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
93 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
94 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
95 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
96 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.25
Nodule 0
Rhizoplane 3.9
Rhizosphere 92.21
Stem 0
Stem Tuber 0
Unclassified 29.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10186905 3300009098 Viruses 1982
2 rootL2_10278956 3300003322 Bacteria 1708
3 Ga0070658_10000076 3300005327 Bacteria 95016
4 Ga0070658_10000336 3300005327 Bacteria 40548
5 Ga0070658_10004011 3300005327 Bacteria 12064
6 Ga0070658_10012838 3300005327 Bacteria 6722
7 Ga0070658_11410851 3300005327 Unclassified 604
8 Ga0070660_100402341 3300005339 Bacteria 1132
9 Ga0070692_10663863 3300005345 Unclassified 697
10 Ga0070675_100660742 3300005354 Unclassified 950
11 Ga0070671_100410317 3300005355 Bacteria 1159
12 Ga0070673_100000531 3300005364 Bacteria 20539
13 Ga0070663_101019279 3300005455 Unclassified 720
14 Ga0070678_100003003 3300005456 Bacteria 9350
15 Ga0070681_10001075 3300005458 Bacteria 23279
16 Ga0070681_10525392 3300005458 Unclassified 1097
17 Ga0070681_10595903 3300005458 Unclassified 1019
18 Ga0070685_10006194 3300005466 Bacteria 6090
19 Ga0070685_10007587 3300005466 Bacteria 5549
20 Ga0070679_100012371 3300005530 Bacteria 8153
21 Ga0070679_100127449 3300005530 Bacteria 2527
22 Ga0070679_100445109 3300005530 Unclassified 1240
23 Ga0070679_101667542 3300005530 Unclassified 585
24 Ga0070684_100443777 3300005535 Unclassified 1199
25 Ga0070684_100875670 3300005535 Bacteria 841
26 Ga0068853_100124073 3300005539 Bacteria 2306
27 Ga0068853_100856295 3300005539 Bacteria 872
28 Ga0070672_100269351 3300005543 Bacteria 1438
29 Ga0070665_100048917 3300005548 Bacteria 4244
30 Ga0070665_100370754 3300005548 Bacteria 1438
31 Ga0068855_100056577 3300005563 Bacteria 4601
32 Ga0068855_100296847 3300005563 Bacteria 1790
33 Ga0068855_102274244 3300005563 Bacteria 543
34 Ga0068857_100025632 3300005577 Bacteria 5191
35 Ga0068857_101679061 3300005577 Bacteria 621
36 Ga0068856_100000002 3300005614 Bacteria 372816
37 Ga0068856_100035167 3300005614 Bacteria 4909
38 Ga0068856_101001092 3300005614 Bacteria 854
39 Ga0068856_102488844 3300005614 Unclassified 524
40 Ga0068863_100127796 3300005841 Bacteria 2425
41 Ga0105245_10029503 3300009098 Bacteria 4847
42 Ga0105245_10054520 3300009098 Unclassified 3591
43 Ga0105245_10182722 3300009098 Bacteria 2004
44 Ga0105245_10183036 3300009098 Bacteria 2003
45 Ga0105242_10014738 3300009176 Bacteria 6054
46 Ga0105242_10024280 3300009176 Bacteria 4786
47 Ga0105242_10195207 3300009176 Bacteria 1795
48 Ga0105248_10356223 3300009177 Unclassified 1647
49 Ga0105248_12688400 3300009177 Bacteria 567
50 Ga0105237_10304906 3300009545 Bacteria 1595
51 Ga0105237_10818576 3300009545 Unclassified 938
52 Ga0105238_10056914 3300009551 Bacteria 3922
53 Ga0105238_10142565 3300009551 Bacteria 2373
54 Ga0105238_10396755 3300009551 Unclassified 1372
55 Ga0105238_10510711 3300009551 Unclassified 1203
56 Ga0105239_10008276 3300010375 Bacteria 11858
57 Ga0157369_10007746 3300013105 Bacteria 12354
58 Ga0157369_10276123 3300013105 Bacteria 1750
59 Ga0157369_11609061 3300013105 Bacteria 660
60 Ga0157374_10000487 3300013296 Bacteria 35920
61 Ga0157374_10002033 3300013296 Bacteria 16987
62 Ga0157374_10023731 3300013296 Bacteria 5490
63 Ga0157374_10900499 3300013296 Bacteria 902
64 Ga0157378_10090748 3300013297 Bacteria 2777
65 Ga0157372_10000487 3300013307 Bacteria 43763
66 Ga0157372_10068294 3300013307 Unclassified 3996
67 Ga0163163_10538464 3300014325 Unclassified 1230
68 Ga0157377_10006941 3300014745 Bacteria 5436
69 Ga0157376_10000001 3300014969 Bacteria 842910
70 Ga0207705_10000019 3300025909 Bacteria 317770
71 Ga0207705_10000423 3300025909 Bacteria 36934
72 Ga0207705_10003441 3300025909 Bacteria 12041
73 Ga0207705_10008440 3300025909 Bacteria 7522
74 Ga0207705_10009881 3300025909 Bacteria 6948
75 Ga0207705_10021960 3300025909 Bacteria 4554
76 Ga0207707_10018994 3300025912 Bacteria 5995
77 Ga0207707_11051257 3300025912 Unclassified 666
78 Ga0207671_10619562 3300025914 Bacteria 862
79 Ga0207660_10009498 3300025917 Bacteria 6295
80 Ga0207657_10000226 3300025919 Bacteria 59005
81 Ga0207657_10368333 3300025919 Bacteria 1132
82 Ga0207652_10005699 3300025921 Bacteria 10110
83 Ga0207652_10016622 3300025921 Bacteria 6011
84 Ga0207652_10113125 3300025921 Bacteria 2409
85 Ga0207652_10383324 3300025921 Unclassified 1269
86 Ga0207694_10062354 3300025924 Bacteria 2903
87 Ga0207659_10542380 3300025926 Unclassified 988
88 Ga0207687_10016694 3300025927 Bacteria 4826
89 Ga0207687_10038140 3300025927 Unclassified 3282
90 Ga0207687_10127312 3300025927 Bacteria 1914
91 Ga0207687_10737106 3300025927 Bacteria 838
92 Ga0207700_11721150 3300025928 Unclassified 553
93 Ga0207644_10090662 3300025931 Unclassified 2278
94 Ga0207686_10765216 3300025934 Unclassified 772
95 Ga0207669_10012953 3300025937 Bacteria 4122
96 Ga0207704_10857185 3300025938 Unclassified 762
97 Ga0207691_10034087 3300025940 Bacteria 4738
98 Ga0207711_10569309 3300025941 Unclassified 1057
99 Ga0207667_10039184 3300025949 Bacteria 5052
100 Ga0207667_10445210 3300025949 Unclassified 1317
101 Ga0207651_10000662 3300025960 Bacteria 14683
102 Ga0207639_10707619 3300026041 Bacteria 935
103 Ga0207702_10000001 3300026078 Bacteria 895738
104 Ga0207702_10072962 3300026078 Bacteria 2959
105 Ga0207702_12107302 3300026078 Unclassified 554
106 Ga0207641_10024555 3300026088 Bacteria 4968
107 Ga0207674_10070364 3300026116 Bacteria 3518
108 Ga0207683_10013766 3300026121 Bacteria 6898
109 Ga0268266_10067374 3300028379 Bacteria 3098
110 Ga0268266_11887252 3300028379 Unclassified 571
111 Ga0268264_11285745 3300028381 Unclassified 742
112 Ga0265319_1148983 3300028563 Unclassified 725
113 Ga0265334_10000028 3300028573 Bacteria 115200
114 Ga0265338_10000368 3300028800 Bacteria 80896
115 Ga0265340_10000999 3300031247 Bacteria 16142
116 Ga0265327_10277290 3300031251 Unclassified 742
117 Ga0265327_10386012 3300031251 Unclassified 609
118 Ga0265327_10387663 3300031251 Unclassified 608
119 Ga0265314_10375922 3300031711 Unclassified 775
120 Ga0395900_0374464 3300037418 Bacteria 1393
121 Ga0395905_1231109 3300037471 Unclassified 652
122 Ga0395901_0020145 3300038443 Bacteria 6826
123 Ga0451807_1924142 3300041486 Unclassified 528
124 Ga0466967_1580831 3300045976 Bacteria 653
125 Ga0496100_0417494 3300048903 Bacteria 1024
126 Ga0496109_0796096 3300048912 Unclassified 883
127 Ga0496110_1644671 3300048913 Unclassified 552
128 Ga0496112_1088728 3300048915 Unclassified 717
129 Ga0496113_1197663 3300048916 Unclassified 593
130 Ga0501031_0000077 3300049568 Bacteria 51667
131 Ga0501032_0001075 3300049569 Bacteria 21871
132 Ga0501034_0001468 3300049571 Bacteria 31240
133 Ga0501036_0008117 3300049572 Bacteria 8603
134 Ga0501037_0000329 3300049573 Bacteria 40132
135 Ga0501037_0650740 3300049573 Bacteria 704
136 Ga0501038_0118982 3300049574 Unclassified 2180
137 Ga0501042_0069800 3300049578 Unclassified 2513
138 Ga0501043_0000182 3300049579 Bacteria 56595
139 Ga0501046_0000061 3300049580 Bacteria 120487
140 Ga0501047_0000676 3300049581 Bacteria 35513
141 Ga0501048_0000024 3300049582 Bacteria 67807
142 Ga0501069_0017787 3300049585 Unclassified 3832
143 Ga0501073_0037255 3300049589 Bacteria 3454
144 Ga0501074_1012581 3300049590 Unclassified 584
145 Ga0501035_0000956 3300049822 Bacteria 30555
146 Ga0501044_0021699 3300049823 Bacteria 6847
147 nmdc:mga0qj67_301385_c1 3300050509 Bacteria 1298
148 Ga0500610_0229243 3300053079 Bacteria 873
149 Ga0500646_0000144 3300053090 Bacteria 20993
150 Ga0500650_0000003 3300053098 Bacteria 164144
151 Ga0500594_0000001 3300053118 Bacteria 1178472
152 Ga0500579_000641 3300053143 Bacteria 20137
153 Ga0501084_0512603 3300054114 Bacteria 1014
154 Ga0501082_0903613 3300060353 Unclassified 772
155 Ga0105245_10186905
156 rootL2_10278956
157 Ga0070658_10000076
158 Ga0070658_10000336
159 Ga0070658_10004011
160 Ga0070658_10012838
161 Ga0070658_11410851
162 Ga0070660_100402341
163 Ga0070692_10663863
164 Ga0070675_100660742
165 Ga0070671_100410317
166 Ga0070673_100000531
167 Ga0070663_101019279
168 Ga0070678_100003003
169 Ga0070681_10001075
170 Ga0070681_10525392
171 Ga0070681_10595903
172 Ga0070685_10006194
173 Ga0070685_10007587
174 Ga0070679_100012371
175 Ga0070679_100127449
176 Ga0070679_100445109
177 Ga0070679_101667542
178 Ga0070684_100443777
179 Ga0070684_100875670
180 Ga0068853_100124073
181 Ga0068853_100856295
182 Ga0070672_100269351
183 Ga0070665_100048917
184 Ga0070665_100370754
185 Ga0068855_100056577
186 Ga0068855_100296847
187 Ga0068855_102274244
188 Ga0068857_100025632
189 Ga0068857_101679061
190 Ga0068856_100000002
191 Ga0068856_100035167
192 Ga0068856_101001092
193 Ga0068856_102488844
194 Ga0068863_100127796
195 Ga0105245_10029503
196 Ga0105245_10054520
197 Ga0105245_10182722
198 Ga0105245_10183036
199 Ga0105242_10014738
200 Ga0105242_10024280
201 Ga0105242_10195207
202 Ga0105248_10356223
203 Ga0105248_12688400
204 Ga0105237_10304906
205 Ga0105237_10818576
206 Ga0105238_10056914
207 Ga0105238_10142565
208 Ga0105238_10396755
209 Ga0105238_10510711
210 Ga0105239_10008276
211 Ga0157369_10007746
212 Ga0157369_10276123
213 Ga0157369_11609061
214 Ga0157374_10000487
215 Ga0157374_10002033
216 Ga0157374_10023731
217 Ga0157374_10900499
218 Ga0157378_10090748
219 Ga0157372_10000487
220 Ga0157372_10068294
221 Ga0163163_10538464
222 Ga0157377_10006941
223 Ga0157376_10000001
224 Ga0207705_10000019
225 Ga0207705_10000423
226 Ga0207705_10003441
227 Ga0207705_10008440
228 Ga0207705_10009881
229 Ga0207705_10021960
230 Ga0207707_10018994
231 Ga0207707_11051257
232 Ga0207671_10619562
233 Ga0207660_10009498
234 Ga0207657_10000226
235 Ga0207657_10368333
236 Ga0207652_10005699
237 Ga0207652_10016622
238 Ga0207652_10113125
239 Ga0207652_10383324
240 Ga0207694_10062354
241 Ga0207659_10542380
242 Ga0207687_10016694
243 Ga0207687_10038140
244 Ga0207687_10127312
245 Ga0207687_10737106
246 Ga0207700_11721150
247 Ga0207644_10090662
248 Ga0207686_10765216
249 Ga0207669_10012953
250 Ga0207704_10857185
251 Ga0207691_10034087
252 Ga0207711_10569309
253 Ga0207667_10039184
254 Ga0207667_10445210
255 Ga0207651_10000662
256 Ga0207639_10707619
257 Ga0207702_10000001
258 Ga0207702_10072962
259 Ga0207702_12107302
260 Ga0207641_10024555
261 Ga0207674_10070364
262 Ga0207683_10013766
263 Ga0268266_10067374
264 Ga0268266_11887252
265 Ga0268264_11285745
266 Ga0265319_1148983
267 Ga0265334_10000028
268 Ga0265338_10000368
269 Ga0265340_10000999
270 Ga0265327_10277290
271 Ga0265327_10386012
272 Ga0265327_10387663
273 Ga0265314_10375922
274 Ga0395900_0374464
275 Ga0395905_1231109
276 Ga0395901_0020145
277 Ga0451807_1924142
278 Ga0466967_1580831
279 Ga0496100_0417494
280 Ga0496109_0796096
281 Ga0496110_1644671
282 Ga0496112_1088728
283 Ga0496113_1197663
284 Ga0501031_0000077
285 Ga0501032_0001075
286 Ga0501034_0001468
287 Ga0501036_0008117
288 Ga0501037_0000329
289 Ga0501037_0650740
290 Ga0501038_0118982
291 Ga0501042_0069800
292 Ga0501043_0000182
293 Ga0501046_0000061
294 Ga0501047_0000676
295 Ga0501048_0000024
296 Ga0501069_0017787
297 Ga0501073_0037255
298 Ga0501074_1012581
299 Ga0501035_0000956
300 Ga0501044_0021699
301 nmdc:mga0qj67_301385_c1
302 Ga0500610_0229243
303 Ga0500646_0000144
304 Ga0500650_0000003
305 Ga0500594_0000001
306 Ga0500579_000641
307 Ga0501084_0512603
308 Ga0501082_0903613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01035

DNA_binding_1

6-O-methylguanine DNA methyltransferase, DNA binding domain

19

98

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4enn-assembly1.cif.gz_A crystal structure of s. pombe atl1 in complex with damaged dna containing o6-carboxymethylguanine 0.8943 5 102
1eh6-assembly1.cif.gz_A human o6-alkylguanine-dna alkyltransferase 0.8686 5 85
1t39-assembly2.cif.gz_B human o6-alkylguanine-dna alkyltransferase covalently crosslinked to dna 0.8625 5 85
1qnt-assembly1.cif.gz_A x-ray structure of human o6alkylguanine-dna alkyltransferase 0.8582 4 85
4zye-assembly1.cif.gz_A crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase 0.8564 8 90
ID Description Score Start End Superfamily
af_O05862_6_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9376 7 102 1.10.10.10
af_O05862_6_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9186 7 102 1.10.10.10
af_A0A1D8PU47_6_130_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8963 8 102 1.10.10.10
af_Q4DAC5_49_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8835 5 88 1.10.10.10
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8782 5 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A258G637-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase DNA binding domain-containing protein 0.9907 8 102 GO:0003824
GO:0006281
AF-A0A0G1VD76-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase DNA binding domain-containing protein 0.9816 4 102 GO:0003824
GO:0006281
AF-A0A1Q7PR73-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase DNA binding domain-containing protein 0.9796 13 103 GO:0003824
GO:0006281
AF-A0A0T6AMH4-F1-model_v4 Methylated-DNA--protein-cysteine methyltransferase 0.9783 25 102 GO:0006281
GO:0008168
GO:0032259
AF-A0A2E8JPF3-F1-model_v4 Cysteine methyltransferase 0.9775 4 102 GO:0006281
GO:0008168
GO:0032259

Map