F219475

General Info

Members Datasets Scaffolds Average Seq Length
154 124 308 261

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10840870|Ga0111539_108408702
Length 288
Sequence VQFVVAGGLTVRGTVGAVEIADKVIVVTGAAGGIGRALARRFHAGGARAVVVGDLAEQGALAVAAELDAARPGSALGLRCDVSTPDGNEALIDATEERFGEVDLFFANAGVALGTDLETSDADWRTAFAVNVEAHYYAARRLLPGWLACGEGYFCSTASAAGLLTQIGSAPYSVTKHAAVAFAEWLSVTYGDQGIRVSCLCPMGVNTNMLNGGNTSGVAALGGDVVRSAGAVLEPEDVAEVCVETIAAERFLILPHPEVLTFFQRKGSDYDRWIAGMRRLQRTVSASR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
15 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
16 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
24 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
26 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
27 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
39 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
40 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
41 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
42 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
43 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
44 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
45 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
46 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
47 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
48 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
49 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
50 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
51 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
52 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
53 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
54 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
55 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
56 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
57 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
60 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
63 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
64 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
65 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
66 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
67 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
68 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
69 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
70 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
71 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
72 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
73 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
74 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
75 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
76 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
77 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
78 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
79 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
80 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
81 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
82 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
83 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
84 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
87 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
88 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
89 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
90 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
111 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
112 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
113 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
115 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
116 2547132424 Nocardia nova SH22a Isolate Unclassified
117 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
118 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
119 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
120 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
121 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
122 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
123 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
124 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 0.65
Isolates 6.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.25
Nodule 0
Rhizoplane 11.69
Rhizosphere 75.97
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10840870 3300009094 Bacteria 1068
2 Ga0068868_100035913 3300005338 Bacteria 3833
3 Ga0070660_100000769 3300005339 Bacteria 21275
4 Ga0070660_100170338 3300005339 Bacteria 1759
5 Ga0070691_10231521 3300005341 Bacteria 983
6 Ga0070714_100114210 3300005435 Bacteria 2395
7 Ga0070714_100728446 3300005435 Bacteria 958
8 Ga0070713_100215914 3300005436 Bacteria 1738
9 Ga0070710_10014121 3300005437 Bacteria 4013
10 Ga0070679_100061164 3300005530 Bacteria 3753
11 Ga0070684_100115106 3300005535 Bacteria 2414
12 Ga0068862_100679892 3300005844 Bacteria 995
13 Ga0070717_10047936 3300006028 Bacteria 3502
14 Ga0075365_10083083 3300006038 Bacteria 2172
15 Ga0075363_100002415 3300006048 Bacteria 7625
16 Ga0070716_100037156 3300006173 Bacteria 2690
17 Ga0070712_100003643 3300006175 Bacteria 9497
18 Ga0075369_10020808 3300006186 Bacteria 2689
19 Ga0075430_100114966 3300006846 Bacteria 2242
20 Ga0075433_10588694 3300006852 Bacteria 977
21 Ga0068865_100264908 3300006881 Bacteria 1362
22 Ga0111539_10044660 3300009094 Bacteria 5308
23 Ga0111539_10515715 3300009094 Bacteria 1393
24 Ga0105245_10236301 3300009098 Bacteria 1770
25 Ga0105243_10001620 3300009148 Bacteria 19586
26 Ga0105243_10491276 3300009148 Bacteria 1161
27 Ga0105246_10028187 3300011119 Bacteria 3687
28 Ga0157376_10270132 3300014969 Bacteria 1597
29 Ga0206353_10628959 3300020082 Bacteria 1761
30 Ga0213876_10003459 3300021384 Bacteria 9029
31 Ga0213875_10005972 3300021388 Bacteria 6457
32 Ga0207426_1019861 3300025302 Bacteria 2343
33 Ga0207705_10033956 3300025909 Bacteria 3646
34 Ga0207693_10004896 3300025915 Bacteria 11254
35 Ga0207693_10562895 3300025915 Bacteria 888
36 Ga0207663_10260740 3300025916 Bacteria 1280
37 Ga0207657_10019372 3300025919 Bacteria 6464
38 Ga0207657_10177964 3300025919 Bacteria 1720
39 Ga0207652_10079158 3300025921 Bacteria 2871
40 Ga0207650_10466716 3300025925 Bacteria 1052
41 Ga0207664_10071481 3300025929 Bacteria 2795
42 Ga0207664_10218693 3300025929 Bacteria 1651
43 Ga0207709_10000598 3300025935 Bacteria 30054
44 Ga0207709_10416273 3300025935 Bacteria 1031
45 Ga0207665_10043470 3300025939 Bacteria 3004
46 Ga0207661_10544833 3300025944 Bacteria 1063
47 Ga0265327_10099651 3300031251 Bacteria 1404
48 Ga0307405_10170262 3300031731 Bacteria 1553
49 Ga0307407_10331503 3300031903 Bacteria 1071
50 Ga0307416_101077013 3300032002 Bacteria 908
51 Ga0307411_10217123 3300032005 Bacteria 1481
52 Ga0307415_100044083 3300032126 Bacteria 2980
53 Ga0373954_0057911 3300035118 Bacteria 1825
54 Ga0373956_0054171 3300035119 Bacteria 1807
55 Ga0373935_0070724 3300035692 Bacteria 2250
56 Ga0373933_0006273 3300035724 Bacteria 6471
57 Ga0373937_0020978 3300036401 Bacteria 5859
58 Ga0436364_0488398 3300037853 Bacteria 13678
59 Ga0436365_0165660 3300039437 Bacteria 3778
60 Ga0436365_0963838 3300039437 Bacteria 1787
61 Ga0436365_1506391 3300039437 Bacteria 4555
62 Ga0436360_1355475 3300039438 Bacteria 2887
63 Ga0436361_0203100 3300039447 Bacteria 1215
64 Ga0436363_1519688 3300039450 Bacteria 940
65 Ga0439436_0017436 3300041404 Bacteria 2149
66 Ga0439433_0001849 3300041999 Bacteria 4416
67 Ga0439449_0015688 3300042007 Bacteria 2848
68 Ga0439457_004651 3300042014 Bacteria 3550
69 Ga0466966_0054958 3300044684 Bacteria 2522
70 Ga0466957_0146073 3300044842 Bacteria 1527
71 Ga0466959_0044884 3300045049 Bacteria 3256
72 Ga0466967_0130665 3300045976 Bacteria 2331
73 Ga0466967_0162349 3300045976 Bacteria 2098
74 Ga0466967_1075685 3300045976 Bacteria 801
75 Ga0495651_0000497 3300046462 Bacteria 30480
76 Ga0495653_0007895 3300046463 Bacteria 8713
77 Ga0495653_0183255 3300046463 Bacteria 1435
78 Ga0495582_0178152 3300046473 Bacteria 1211
79 Ga0495664_0052146 3300046477 Bacteria 2430
80 Ga0495608_0000564 3300046511 Bacteria 25451
81 Ga0495618_0005317 3300046514 Bacteria 7858
82 Ga0495628_0010021 3300046516 Bacteria 8063
83 Ga0495652_0013239 3300046529 Bacteria 7425
84 Ga0495640_0011328 3300046533 Bacteria 6866
85 Ga0495587_0010465 3300046536 Bacteria 5902
86 Ga0495587_0236221 3300046536 Bacteria 1029
87 Ga0495667_0006223 3300046559 Bacteria 8088
88 Ga0495667_0305029 3300046559 Bacteria 1008
89 Ga0495634_0011902 3300046642 Bacteria 6320
90 Ga0495635_0008979 3300046663 Bacteria 6977
91 Ga0495657_0003398 3300046675 Bacteria 13000
92 Ga0495599_0048644 3300046678 Bacteria 2658
93 Ga0495623_0020622 3300046679 Bacteria 4259
94 Ga0495646_0022036 3300046680 Bacteria 4021
95 Ga0495646_0091726 3300046680 Bacteria 1753
96 Ga0495669_0000491 3300046684 Bacteria 18182
97 Ga0495613_0128892 3300046689 Bacteria 1812
98 Ga0495613_0387462 3300046689 Bacteria 955
99 Ga0495600_0043145 3300046809 Bacteria 2940
100 Ga0495581_0026562 3300047315 Bacteria 3356
101 Ga0495604_0003667 3300047317 Bacteria 12241
102 Ga0495604_0447825 3300047317 Bacteria 844
103 Ga0495674_0012561 3300047319 Bacteria 7979
104 Ga0495680_0005033 3300047322 Bacteria 12496
105 Ga0495680_0082943 3300047322 Bacteria 2418
106 Ga0495677_0008205 3300047445 Bacteria 3881
107 Ga0495684_0003190 3300047471 Bacteria 12861
108 Ga0495593_0053736 3300047673 Bacteria 2125
109 Ga0495602_0005533 3300048088 Bacteria 13255
110 Ga0495602_0267911 3300048088 Bacteria 1264
111 Ga0495602_0285533 3300048088 Bacteria 1214
112 Ga0496100_0027910 3300048903 Bacteria 3476
113 Ga0496101_0506172 3300048904 Bacteria 954
114 Ga0496102_0008894 3300048905 Bacteria 8619
115 Ga0496104_0069826 3300048907 Bacteria 3339
116 Ga0496104_0090779 3300048907 Bacteria 2919
117 Ga0496105_0032523 3300048908 Bacteria 4281
118 Ga0496105_0060246 3300048908 Bacteria 3132
119 Ga0496106_0005928 3300048909 Bacteria 9030
120 Ga0496107_0005442 3300048910 Bacteria 8716
121 Ga0496108_0170000 3300048911 Bacteria 1886
122 Ga0496108_0170203 3300048911 Bacteria 1885
123 Ga0496109_0703409 3300048912 Unclassified 948
124 Ga0496112_0059217 3300048915 Bacteria 3773
125 Ga0496112_0491956 3300048915 Bacteria 1162
126 Ga0496114_0087908 3300048917 Bacteria 2636
127 Ga0496114_0292551 3300048917 Bacteria 1437
128 Ga0496115_0011852 3300048918 Bacteria 6549
129 Ga0496115_0171239 3300048918 Bacteria 1796
130 Ga0501034_0006306 3300049571 Bacteria 12765
131 Ga0501034_0169094 3300049571 Bacteria 2154
132 Ga0501036_0291846 3300049572 Bacteria 1364
133 Ga0501041_0108411 3300049577 Bacteria 1722
134 Ga0501071_0213039 3300049587 Bacteria 1453
135 Ga0501072_0351859 3300049588 Bacteria 1170
136 Ga0501079_0109434 3300049741 Bacteria 2146
137 nmdc:mga09592_293593_c1 3300050508 Bacteria 1409
138 nmdc:mga08y16_68465_c1 3300050511 Bacteria 3701
139 Ga0495601_0088409 3300053077 Bacteria 1992
140 Ga0495601_0336800 3300053077 Bacteria 982
141 Ga0495595_0015133 3300053084 Bacteria 3286
142 Ga0495619_0006263 3300053085 Bacteria 7545
143 Ga0500650_0000016 3300053098 Bacteria 70975
144 Ga0501082_0423816 3300060353 Bacteria 1162
145 2523383920 2523231044 Bacteria 6434991
146 2548696195 2547132424 Bacteria 8348532
147 2738666495 2738541264 Bacteria 5935393
148 2739146419 2738541356 Bacteria 5935017
149 2739239632 2738543011 Bacteria 5731169
150 2753034733 2751185725 Bacteria 5740550
151 2753323250 2751185792 Bacteria 5739090
152 2857712254 2857710386 Bacteria 3186771
153 2889304691 2889300758 Bacteria 5690814
154 2939744923 2939743619 Bacteria 5762299
155 Ga0111539_10840870
156 Ga0068868_100035913
157 Ga0070660_100000769
158 Ga0070660_100170338
159 Ga0070691_10231521
160 Ga0070714_100114210
161 Ga0070714_100728446
162 Ga0070713_100215914
163 Ga0070710_10014121
164 Ga0070679_100061164
165 Ga0070684_100115106
166 Ga0068862_100679892
167 Ga0070717_10047936
168 Ga0075365_10083083
169 Ga0075363_100002415
170 Ga0070716_100037156
171 Ga0070712_100003643
172 Ga0075369_10020808
173 Ga0075430_100114966
174 Ga0075433_10588694
175 Ga0068865_100264908
176 Ga0111539_10044660
177 Ga0111539_10515715
178 Ga0105245_10236301
179 Ga0105243_10001620
180 Ga0105243_10491276
181 Ga0105246_10028187
182 Ga0157376_10270132
183 Ga0206353_10628959
184 Ga0213876_10003459
185 Ga0213875_10005972
186 Ga0207426_1019861
187 Ga0207705_10033956
188 Ga0207693_10004896
189 Ga0207693_10562895
190 Ga0207663_10260740
191 Ga0207657_10019372
192 Ga0207657_10177964
193 Ga0207652_10079158
194 Ga0207650_10466716
195 Ga0207664_10071481
196 Ga0207664_10218693
197 Ga0207709_10000598
198 Ga0207709_10416273
199 Ga0207665_10043470
200 Ga0207661_10544833
201 Ga0265327_10099651
202 Ga0307405_10170262
203 Ga0307407_10331503
204 Ga0307416_101077013
205 Ga0307411_10217123
206 Ga0307415_100044083
207 Ga0373954_0057911
208 Ga0373956_0054171
209 Ga0373935_0070724
210 Ga0373933_0006273
211 Ga0373937_0020978
212 Ga0436364_0488398
213 Ga0436365_0165660
214 Ga0436365_0963838
215 Ga0436365_1506391
216 Ga0436360_1355475
217 Ga0436361_0203100
218 Ga0436363_1519688
219 Ga0439436_0017436
220 Ga0439433_0001849
221 Ga0439449_0015688
222 Ga0439457_004651
223 Ga0466966_0054958
224 Ga0466957_0146073
225 Ga0466959_0044884
226 Ga0466967_0130665
227 Ga0466967_0162349
228 Ga0466967_1075685
229 Ga0495651_0000497
230 Ga0495653_0007895
231 Ga0495653_0183255
232 Ga0495582_0178152
233 Ga0495664_0052146
234 Ga0495608_0000564
235 Ga0495618_0005317
236 Ga0495628_0010021
237 Ga0495652_0013239
238 Ga0495640_0011328
239 Ga0495587_0010465
240 Ga0495587_0236221
241 Ga0495667_0006223
242 Ga0495667_0305029
243 Ga0495634_0011902
244 Ga0495635_0008979
245 Ga0495657_0003398
246 Ga0495599_0048644
247 Ga0495623_0020622
248 Ga0495646_0022036
249 Ga0495646_0091726
250 Ga0495669_0000491
251 Ga0495613_0128892
252 Ga0495613_0387462
253 Ga0495600_0043145
254 Ga0495581_0026562
255 Ga0495604_0003667
256 Ga0495604_0447825
257 Ga0495674_0012561
258 Ga0495680_0005033
259 Ga0495680_0082943
260 Ga0495677_0008205
261 Ga0495684_0003190
262 Ga0495593_0053736
263 Ga0495602_0005533
264 Ga0495602_0267911
265 Ga0495602_0285533
266 Ga0496100_0027910
267 Ga0496101_0506172
268 Ga0496102_0008894
269 Ga0496104_0069826
270 Ga0496104_0090779
271 Ga0496105_0032523
272 Ga0496105_0060246
273 Ga0496106_0005928
274 Ga0496107_0005442
275 Ga0496108_0170000
276 Ga0496108_0170203
277 Ga0496109_0703409
278 Ga0496112_0059217
279 Ga0496112_0491956
280 Ga0496114_0087908
281 Ga0496114_0292551
282 Ga0496115_0011852
283 Ga0496115_0171239
284 Ga0501034_0006306
285 Ga0501034_0169094
286 Ga0501036_0291846
287 Ga0501041_0108411
288 Ga0501071_0213039
289 Ga0501072_0351859
290 Ga0501079_0109434
291 nmdc:mga09592_293593_c1
292 nmdc:mga08y16_68465_c1
293 Ga0495601_0088409
294 Ga0495601_0336800
295 Ga0495595_0015133
296 Ga0495619_0006263
297 Ga0500650_0000016
298 Ga0501082_0423816
299 2523383920
300 2548696195
301 2738666495
302 2739146419
303 2739239632
304 2753034733
305 2753323250
306 2857712254
307 2889304691
308 2939744923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

23

216

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

29

247

0.91

PF08659

KR

KR domain

23

200

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

25

217

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zzo-assembly1.cif.gz_A-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate 0.9465 2 188
6zzp-assembly2.cif.gz_D-3 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and 3-oxovalerate 0.9459 2 188
2et6-assembly1.cif.gz_A (3r)-hydroxyacyl-coa dehydrogenase domain of candida tropicalis peroxisomal multifunctional enzyme type 2 0.9315 2 181
7ulh-assembly1.cif.gz_E crystal structure of a short chain dehydrogenase from mycobacterium avium 104 0.9276 3 181
1gz6-assembly2.cif.gz_C (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9273 1 181
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9398 88 187 3.40.50.720
2et6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.932 2 181 3.40.50.720
af_A0A0R0FEP1_20_274_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9264 7 184 3.40.50.720
af_Q0D3U8_30_207_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9232 2 165 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9196 2 191 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2S8BKK7-F1-model_v4 1-deoxy-11-beta-hydroxypentalenate dehydrogenase (EC 1.1.1.340) 0.9911 43 267 GO:0016491
AF-H6R222-F1-model_v4 Putative short chain dehydrogenase 0.9897 1 266 GO:0016491
AF-A0A1A3MX14-F1-model_v4 Dehydrogenase 0.9819 1 269 GO:0016491
AF-A0A829PS81-F1-model_v4 Putative short chain dehydrogenase 0.9807 123 268 GO:0016491
AF-A0A1U1PJ53-F1-model_v4 deleted 0.9798 74 268

Map