F218892
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 154 | 120 | 152 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100182929|Ga0070671_1001829291 |
| Length | 372 |
| Sequence | MIAVNAAAVCAPTPSSEPAHCKGRIDPMSHHYSGPALGFPHGDARLDLTDLYAFGKPGDDRKSILIMNVHPSFSLEPRGPTRSDPFAHEAIYELKIDTDGDSVADIAYRVRFTVFERGAQTATLRCVRGAAAAGVGDTGDVLIEAAPVSLGQTPRITEVGEHRLFAGWRSDPFFFDVLGVLDGFKFSHQDFFADKDVCSIVLEIPNVSLGPGRVGIWARTLDGAGGRWVQADRGARPAQTPFLTGEAIAAYTAAEPVDDRQFVSVFAHSLEHAGGYTPADAERVAATLLPDIMPFDHARPVSYPENGRALTHDTQDHFLSILTNGRVTTDGVGPHSDLLADFPYLGPPHAGVAPFATPPPVPASEATNTNVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 16 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 22 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 23 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 24 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 28 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 29 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 30 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 31 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 32 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 44 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 46 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 48 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 50 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 51 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 72 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 74 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 75 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 76 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 77 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 78 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 79 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 80 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 81 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 82 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 83 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 84 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 85 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 86 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 87 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 88 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 89 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 90 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 91 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 92 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 93 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 94 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 95 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 96 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 97 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 99 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 100 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 101 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 102 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 103 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 113 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 114 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 115 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 116 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 117 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 119 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 120 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.05 |
| Metatranscriptomes | 0.65 |
| Isolates | 1.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.79 |
| Nodule | 0.65 |
| Rhizoplane | 0.65 |
| Rhizosphere | 85.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1003172 | 3300003214 | Bacteria | 4337 |
| 2 | rootH1_10217441 | 3300003323 | Bacteria | 10456 |
| 3 | Ga0055526_1001946 | 3300003771 | Bacteria | 14296 |
| 4 | Ga0055528_1001473 | 3300003790 | Bacteria | 14311 |
| 5 | Ga0070660_100042511 | 3300005339 | Bacteria | 3469 |
| 6 | Ga0070671_100182929 | 3300005355 | Bacteria | 1775 |
| 7 | Ga0070659_100013195 | 3300005366 | Bacteria | 6145 |
| 8 | Ga0070713_100000454 | 3300005436 | Bacteria | 26216 |
| 9 | Ga0070713_100086520 | 3300005436 | Bacteria | 2687 |
| 10 | Ga0070700_100140624 | 3300005441 | Bacteria | 1640 |
| 11 | Ga0070681_10259674 | 3300005458 | Bacteria | 1649 |
| 12 | Ga0070706_100090033 | 3300005467 | Bacteria | 2845 |
| 13 | Ga0070698_100005544 | 3300005471 | Bacteria | 13794 |
| 14 | Ga0068853_100343211 | 3300005539 | Bacteria | 1388 |
| 15 | Ga0070672_100232847 | 3300005543 | Bacteria | 1548 |
| 16 | Ga0070695_100007105 | 3300005545 | Bacteria | 6636 |
| 17 | Ga0070665_100022332 | 3300005548 | Bacteria | 6368 |
| 18 | Ga0068855_100000034 | 3300005563 | Bacteria | 166436 |
| 19 | Ga0070664_100192687 | 3300005564 | Bacteria | 1816 |
| 20 | Ga0068852_100001775 | 3300005616 | Bacteria | 14678 |
| 21 | Ga0068861_100035388 | 3300005719 | Bacteria | 3699 |
| 22 | Ga0068861_100378447 | 3300005719 | Bacteria | 1250 |
| 23 | Ga0081540_1098320 | 3300005983 | Bacteria | 1267 |
| 24 | Ga0070717_10001065 | 3300006028 | Bacteria | 18424 |
| 25 | Ga0070715_10062607 | 3300006163 | Bacteria | 1638 |
| 26 | Ga0097621_100314463 | 3300006237 | Bacteria | 1386 |
| 27 | Ga0075431_100390875 | 3300006847 | Unclassified | 1393 |
| 28 | Ga0075431_100551061 | 3300006847 | Bacteria | 1140 |
| 29 | Ga0075433_10014886 | 3300006852 | Bacteria | 6366 |
| 30 | Ga0075434_100007999 | 3300006871 | Bacteria | 9802 |
| 31 | Ga0068865_100089762 | 3300006881 | Bacteria | 2227 |
| 32 | Ga0099794_10032343 | 3300007265 | Unclassified | 2455 |
| 33 | Ga0105240_10000382 | 3300009093 | Bacteria | 83108 |
| 34 | Ga0105240_10001551 | 3300009093 | Bacteria | 38976 |
| 35 | Ga0111539_10069970 | 3300009094 | Bacteria | 4143 |
| 36 | Ga0111539_10432650 | 3300009094 | Bacteria | 1532 |
| 37 | Ga0114129_10098667 | 3300009147 | Bacteria | 4043 |
| 38 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 39 | Ga0105248_10028223 | 3300009177 | Bacteria | 6251 |
| 40 | Ga0105248_10401332 | 3300009177 | Unclassified | 1544 |
| 41 | Ga0105238_10088899 | 3300009551 | Bacteria | 3076 |
| 42 | Ga0105238_10157432 | 3300009551 | Bacteria | 2247 |
| 43 | Ga0105238_10407001 | 3300009551 | Unclassified | 1354 |
| 44 | Ga0099796_10072659 | 3300010159 | Unclassified | 1245 |
| 45 | Ga0105239_10036619 | 3300010375 | Bacteria | 5386 |
| 46 | Ga0105239_10327853 | 3300010375 | Bacteria | 1727 |
| 47 | Ga0157371_10067794 | 3300013102 | Bacteria | 2525 |
| 48 | Ga0157374_10090815 | 3300013296 | Unclassified | 2912 |
| 49 | Ga0157372_10466371 | 3300013307 | Unclassified | 1472 |
| 50 | Ga0157372_10633987 | 3300013307 | Bacteria | 1245 |
| 51 | Ga0163163_10134207 | 3300014325 | Bacteria | 2516 |
| 52 | Ga0213871_10000930 | 3300021441 | Bacteria | 4510 |
| 53 | Ga0209677_100323 | 3300025253 | Bacteria | 30849 |
| 54 | Ga0209759_1010510 | 3300025256 | Bacteria | 2708 |
| 55 | Ga0209233_1000322 | 3300025261 | Bacteria | 51917 |
| 56 | Ga0209233_1000326 | 3300025261 | Bacteria | 50250 |
| 57 | Ga0209673_1002190 | 3300025273 | Bacteria | 14364 |
| 58 | Ga0209025_1030233 | 3300025294 | Bacteria | 2598 |
| 59 | Ga0209564_1002493 | 3300025295 | Bacteria | 14353 |
| 60 | Ga0209256_1002596 | 3300025299 | Bacteria | 14339 |
| 61 | Ga0207684_10000751 | 3300025910 | Bacteria | 37862 |
| 62 | Ga0207707_10208461 | 3300025912 | Bacteria | 1703 |
| 63 | Ga0207695_10000004 | 3300025913 | Bacteria | 1288665 |
| 64 | Ga0207695_10013991 | 3300025913 | Bacteria | 9531 |
| 65 | Ga0207695_10108497 | 3300025913 | Bacteria | 2760 |
| 66 | Ga0207694_10000010 | 3300025924 | Bacteria | 439722 |
| 67 | Ga0207700_10000341 | 3300025928 | Bacteria | 27463 |
| 68 | Ga0207700_10001777 | 3300025928 | Bacteria | 12232 |
| 69 | Ga0207664_10335534 | 3300025929 | Bacteria | 1336 |
| 70 | Ga0207644_10131413 | 3300025931 | Bacteria | 1917 |
| 71 | Ga0207704_10054160 | 3300025938 | Bacteria | 2444 |
| 72 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 73 | Ga0207711_10149590 | 3300025941 | Bacteria | 2106 |
| 74 | Ga0207661_10275088 | 3300025944 | Bacteria | 1503 |
| 75 | Ga0207679_10190065 | 3300025945 | Bacteria | 1706 |
| 76 | Ga0207667_10000065 | 3300025949 | Bacteria | 186655 |
| 77 | Ga0207703_10324341 | 3300026035 | Bacteria | 1411 |
| 78 | Ga0207708_10006032 | 3300026075 | Bacteria | 8980 |
| 79 | Ga0207641_10138965 | 3300026088 | Bacteria | 2189 |
| 80 | Ga0207674_10016378 | 3300026116 | Bacteria | 8117 |
| 81 | Ga0207675_100052088 | 3300026118 | Bacteria | 3820 |
| 82 | Ga0207675_100322910 | 3300026118 | Bacteria | 1507 |
| 83 | Ga0207683_10074910 | 3300026121 | Bacteria | 2995 |
| 84 | Ga0207698_10005454 | 3300026142 | Bacteria | 7866 |
| 85 | Ga0209588_1063667 | 3300027671 | Unclassified | 1192 |
| 86 | Ga0207428_10005645 | 3300027907 | Bacteria | 11630 |
| 87 | Ga0268266_10055944 | 3300028379 | Bacteria | 3393 |
| 88 | Ga0265318_10002500 | 3300028577 | Bacteria | 9807 |
| 89 | Ga0265338_10007789 | 3300028800 | Bacteria | 13174 |
| 90 | Ga0265762_1001333 | 3300030760 | Unclassified | 4498 |
| 91 | Ga0265313_10074246 | 3300031595 | Unclassified | 1560 |
| 92 | Ga0307508_10000701 | 3300031616 | Bacteria | 39935 |
| 93 | Ga0307516_10091501 | 3300031730 | Bacteria | 2870 |
| 94 | Ga0307516_10122137 | 3300031730 | Bacteria | 2393 |
| 95 | Ga0307405_10243625 | 3300031731 | Bacteria | 1333 |
| 96 | Ga0307410_10008063 | 3300031852 | Bacteria | 5817 |
| 97 | Ga0307406_10005439 | 3300031901 | Bacteria | 6970 |
| 98 | Ga0307407_10022591 | 3300031903 | Bacteria | 3267 |
| 99 | Ga0307412_10087104 | 3300031911 | Bacteria | 2175 |
| 100 | Ga0307409_100311083 | 3300031995 | Bacteria | 1470 |
| 101 | Ga0307416_100265696 | 3300032002 | Bacteria | 1680 |
| 102 | Ga0307414_10004070 | 3300032004 | Bacteria | 7884 |
| 103 | Ga0307415_100000742 | 3300032126 | Bacteria | 14690 |
| 104 | Ga0307510_10000003 | 3300033180 | Bacteria | 756654 |
| 105 | Ga0307510_10015859 | 3300033180 | Bacteria | 8904 |
| 106 | Ga0373923_0006028 | 3300035111 | Bacteria | 4159 |
| 107 | Ga0373945_0000279 | 3300035116 | Bacteria | 14440 |
| 108 | Ga0373945_0055116 | 3300035116 | Bacteria | 1471 |
| 109 | Ga0373943_0084589 | 3300035170 | Bacteria | 1632 |
| 110 | Ga0373955_0001575 | 3300035172 | Bacteria | 9753 |
| 111 | Ga0373924_0000148 | 3300035410 | Bacteria | 20572 |
| 112 | Ga0373935_0000314 | 3300035692 | Bacteria | 24181 |
| 113 | Ga0373927_0003000 | 3300035695 | Bacteria | 12251 |
| 114 | Ga0373927_0004070 | 3300035695 | Bacteria | 10318 |
| 115 | Ga0373927_0207697 | 3300035695 | Bacteria | 1286 |
| 116 | Ga0373947_0000124 | 3300035725 | Bacteria | 38940 |
| 117 | Ga0373937_0055978 | 3300036401 | Bacteria | 3621 |
| 118 | Ga0373925_0000406 | 3300037068 | Bacteria | 43897 |
| 119 | Ga0373925_0028852 | 3300037068 | Bacteria | 4068 |
| 120 | Ga0373925_0037162 | 3300037068 | Bacteria | 3594 |
| 121 | Ga0395905_0016798 | 3300037471 | Bacteria | 6953 |
| 122 | Ga0436360_0149002 | 3300039438 | Unclassified | 1168 |
| 123 | Ga0436360_0304671 | 3300039438 | Bacteria | 8371 |
| 124 | Ga0436360_0531402 | 3300039438 | Bacteria | 3545 |
| 125 | Ga0436360_0931190 | 3300039438 | Bacteria | 11567 |
| 126 | Ga0436361_0320433 | 3300039447 | Bacteria | 2148 |
| 127 | Ga0436362_1202203 | 3300039453 | Bacteria | 1419 |
| 128 | Ga0495603_0096204 | 3300046455 | Bacteria | 1730 |
| 129 | Ga0495580_0203564 | 3300046472 | Bacteria | 1363 |
| 130 | Ga0495582_0067813 | 3300046473 | Bacteria | 1972 |
| 131 | Ga0495585_0037526 | 3300046492 | Bacteria | 2729 |
| 132 | Ga0495665_0031849 | 3300046531 | Bacteria | 2821 |
| 133 | Ga0495667_0014320 | 3300046559 | Bacteria | 5357 |
| 134 | Ga0495635_0036152 | 3300046663 | Unclassified | 3424 |
| 135 | Ga0495658_0004322 | 3300046683 | Bacteria | 6998 |
| 136 | Ga0495581_0092341 | 3300047315 | Unclassified | 1757 |
| 137 | Ga0496113_0163191 | 3300048916 | Bacteria | 1762 |
| 138 | Ga0496126_0000485 | 3300048929 | Bacteria | 78597 |
| 139 | Ga0496126_0007358 | 3300048929 | Bacteria | 12081 |
| 140 | nmdc:mga05p37_48397_c1 | 3300050507 | Bacteria | 5229 |
| 141 | nmdc:mga06r32_129323_c1 | 3300050510 | Bacteria | 2496 |
| 142 | nmdc:mga06r32_242193_c1 | 3300050510 | Bacteria | 1791 |
| 143 | nmdc:mga08y16_279119_c1 | 3300050511 | Bacteria | 1723 |
| 144 | nmdc:mga08y16_4664_c1 | 3300050511 | Bacteria | 14279 |
| 145 | nmdc:mga0n895_2340_c1 | 3300050512 | Bacteria | 14769 |
| 146 | nmdc:mga0n895_59720_c1 | 3300050512 | Bacteria | 3762 |
| 147 | nmdc:mga08x19_168701_c1 | 3300050514 | Unclassified | 1490 |
| 148 | nmdc:mga0a205_11452_c1 | 3300050515 | Bacteria | 8165 |
| 149 | nmdc:mga0a205_273705_c1 | 3300050515 | Bacteria | 1565 |
| 150 | nmdc:mga0a205_3740_c1 | 3300050515 | Bacteria | 13628 |
| 151 | Ga0500651_0054631 | 3300053093 | Bacteria | 2502 |
| 152 | Ga0500651_0122560 | 3300053093 | Bacteria | 1577 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021441 | Ga0213871_10000930 | Ga0213871_100009303 | 282 |
| 2 | 3300046472 | Ga0495580_0203564 | Ga0495580_0203564_353_1258 | 294 |
| 3 | 3300039438 | Ga0436360_0531402 | Ga0436360_0531402_1556_2554 | 300 |
| 4 | 3300039453 | Ga0436362_1202203 | Ga0436362_1202203_62_1060 | 300 |
| 5 | 3300010375 | Ga0105239_10327853 | Ga0105239_103278532 | 306 |
| 6 | 3300050510 | nmdc:mga06r32_242193_c1 | nmdc:mga06r32_242193_c1_858_1781 | 307 |
| 7 | 3300050515 | nmdc:mga0a205_273705_c1 | nmdc:mga0a205_273705_c1_46_969 | 307 |
| 8 | 3300009094 | Ga0111539_10432650 | Ga0111539_104326501 | 308 |
| 9 | 3300005563 | Ga0068855_100000034 | Ga0068855_100000034127 | 314 |
| 10 | 3300009093 | Ga0105240_10000382 | Ga0105240_100003827 | 314 |
| 11 | 3300009177 | Ga0105248_10401332 | Ga0105248_104013322 | 314 |
| 12 | 3300025913 | Ga0207695_10000004 | Ga0207695_100000041105 | 314 |
| 13 | 3300025949 | Ga0207667_10000065 | Ga0207667_1000006583 | 314 |
| 14 | 3300035116 | Ga0373945_0055116 | Ga0373945_0055116_411_1436 | 316 |
| 15 | 3300039447 | Ga0436361_0320433 | Ga0436361_0320433_492_1484 | 318 |
| 16 | 3300014325 | Ga0163163_10134207 | Ga0163163_101342073 | 320 |
| 17 | 3300025256 | Ga0209759_1010510 | Ga0209759_10105102 | 320 |
| 18 | 3300005467 | Ga0070706_100090033 | Ga0070706_1000900334 | 322 |
| 19 | 3300006028 | Ga0070717_10001065 | Ga0070717_1000106511 | 322 |
| 20 | 3300025910 | Ga0207684_10000751 | Ga0207684_100007513 | 322 |
| 21 | iso_pu_bacteria | 2503198000 | 2503202463 | 322 |
| 22 | 3300005983 | Ga0081540_1098320 | Ga0081540_10983201 | 323 |
| 23 | 3300007265 | Ga0099794_10032343 | Ga0099794_100323433 | 323 |
| 24 | 3300009551 | Ga0105238_10157432 | Ga0105238_101574322 | 323 |
| 25 | 3300013307 | Ga0157372_10633987 | Ga0157372_106339872 | 323 |
| 26 | 3300027671 | Ga0209588_1063667 | Ga0209588_10636672 | 323 |
| 27 | 3300005339 | Ga0070660_100042511 | Ga0070660_1000425111 | 324 |
| 28 | 3300005366 | Ga0070659_100013195 | Ga0070659_1000131951 | 324 |
| 29 | 3300005458 | Ga0070681_10259674 | Ga0070681_102596742 | 324 |
| 30 | 3300005471 | Ga0070698_100005544 | Ga0070698_1000055443 | 324 |
| 31 | 3300005539 | Ga0068853_100343211 | Ga0068853_1003432112 | 324 |
| 32 | 3300005564 | Ga0070664_100192687 | Ga0070664_1001926872 | 324 |
| 33 | 3300005616 | Ga0068852_100001775 | Ga0068852_1000017752 | 324 |
| 34 | 3300006852 | Ga0075433_10014886 | Ga0075433_100148866 | 324 |
| 35 | 3300006871 | Ga0075434_100007999 | Ga0075434_1000079997 | 324 |
| 36 | 3300009094 | Ga0111539_10069970 | Ga0111539_100699702 | 324 |
| 37 | 3300009147 | Ga0114129_10098667 | Ga0114129_100986676 | 324 |
| 38 | 3300009177 | Ga0105248_10000001 | Ga0105248_10000001258 | 324 |
| 39 | 3300009551 | Ga0105238_10088899 | Ga0105238_100888992 | 324 |
| 40 | 3300010375 | Ga0105239_10036619 | Ga0105239_100366194 | 324 |
| 41 | 3300013102 | Ga0157371_10067794 | Ga0157371_100677941 | 324 |
| 42 | 3300025912 | Ga0207707_10208461 | Ga0207707_102084612 | 324 |
| 43 | 3300025913 | Ga0207695_10108497 | Ga0207695_101084971 | 324 |
| 44 | 3300025924 | Ga0207694_10000010 | Ga0207694_10000010143 | 324 |
| 45 | 3300025941 | Ga0207711_10000002 | Ga0207711_10000002959 | 324 |
| 46 | 3300025944 | Ga0207661_10275088 | Ga0207661_102750882 | 324 |
| 47 | 3300025945 | Ga0207679_10190065 | Ga0207679_101900652 | 324 |
| 48 | 3300026116 | Ga0207674_10016378 | Ga0207674_100163785 | 324 |
| 49 | 3300026142 | Ga0207698_10005454 | Ga0207698_100054543 | 324 |
| 50 | 3300027907 | Ga0207428_10005645 | Ga0207428_100056457 | 324 |
| 51 | 3300031730 | Ga0307516_10091501 | Ga0307516_100915012 | 324 |
| 52 | 3300033180 | Ga0307510_10000003 | Ga0307510_10000003554 | 324 |
| 53 | 3300033180 | Ga0307510_10015859 | Ga0307510_100158598 | 324 |
| 54 | 3300039438 | Ga0436360_0149002 | Ga0436360_0149002_121_1095 | 324 |
| 55 | 3300048916 | Ga0496113_0163191 | Ga0496113_0163191_618_1643 | 324 |
| 56 | 3300050507 | nmdc:mga05p37_48397_c1 | nmdc:mga05p37_48397_c1_796_1770 | 324 |
| 57 | 3300050511 | nmdc:mga08y16_279119_c1 | nmdc:mga08y16_279119_c1_55_1029 | 324 |
| 58 | 3300050511 | nmdc:mga08y16_4664_c1 | nmdc:mga08y16_4664_c1_7344_8318 | 324 |
| 59 | 3300050512 | nmdc:mga0n895_2340_c1 | nmdc:mga0n895_2340_c1_12089_13063 | 324 |
| 60 | 3300050515 | nmdc:mga0a205_3740_c1 | nmdc:mga0a205_3740_c1_2654_3628 | 324 |
| 61 | 3300053093 | Ga0500651_0054631 | Ga0500651_0054631_1458_2432 | 324 |
| 62 | 3300006163 | Ga0070715_10062607 | Ga0070715_100626072 | 325 |
| 63 | 3300028577 | Ga0265318_10002500 | Ga0265318_100025009 | 325 |
| 64 | 3300031595 | Ga0265313_10074246 | Ga0265313_100742462 | 325 |
| 65 | 3300037471 | Ga0395905_0016798 | Ga0395905_0016798_2682_3659 | 325 |
| 66 | 3300006847 | Ga0075431_100551061 | Ga0075431_1005510612 | 327 |
| 67 | 3300006881 | Ga0068865_100089762 | Ga0068865_1000897621 | 327 |
| 68 | 3300025929 | Ga0207664_10335534 | Ga0207664_103355342 | 327 |
| 69 | 3300025938 | Ga0207704_10054160 | Ga0207704_100541602 | 327 |
| 70 | 3300026121 | Ga0207683_10074910 | Ga0207683_100749103 | 327 |
| 71 | 3300039438 | Ga0436360_0304671 | Ga0436360_0304671_4438_5430 | 327 |
| 72 | 3300046492 | Ga0495585_0037526 | Ga0495585_0037526_418_1401 | 327 |
| 73 | 3300050512 | nmdc:mga0n895_59720_c1 | nmdc:mga0n895_59720_c1_2548_3531 | 327 |
| 74 | 3300050514 | nmdc:mga08x19_168701_c1 | nmdc:mga08x19_168701_c1_179_1162 | 327 |
| 75 | 3300050515 | nmdc:mga0a205_11452_c1 | nmdc:mga0a205_11452_c1_2629_3612 | 327 |
| 76 | 3300028800 | Ga0265338_10007789 | Ga0265338_1000778912 | 328 |
| 77 | 3300053093 | Ga0500651_0122560 | Ga0500651_0122560_84_1070 | 328 |
| 78 | 3300030760 | Ga0265762_1001333 | Ga0265762_10013333 | 329 |
| 79 | 3300048929 | Ga0496126_0007358 | Ga0496126_0007358_3770_4759 | 329 |
| 80 | 3300039438 | Ga0436360_0931190 | Ga0436360_0931190_9693_10685 | 330 |
| 81 | 3300005719 | Ga0068861_100378447 | Ga0068861_1003784471 | 331 |
| 82 | 3300009093 | Ga0105240_10001551 | Ga0105240_1000155134 | 331 |
| 83 | 3300009551 | Ga0105238_10407001 | Ga0105238_104070012 | 331 |
| 84 | 3300013307 | Ga0157372_10466371 | Ga0157372_104663712 | 331 |
| 85 | 3300025913 | Ga0207695_10013991 | Ga0207695_100139919 | 331 |
| 86 | 3300026035 | Ga0207703_10324341 | Ga0207703_103243411 | 331 |
| 87 | 3300026118 | Ga0207675_100322910 | Ga0207675_1003229101 | 331 |
| 88 | 3300005436 | Ga0070713_100000454 | Ga0070713_1000004547 | 332 |
| 89 | 3300005436 | Ga0070713_100086520 | Ga0070713_1000865202 | 332 |
| 90 | 3300006237 | Ga0097621_100314463 | Ga0097621_1003144631 | 332 |
| 91 | 3300006847 | Ga0075431_100390875 | Ga0075431_1003908752 | 332 |
| 92 | 3300010159 | Ga0099796_10072659 | Ga0099796_100726591 | 332 |
| 93 | 3300025928 | Ga0207700_10000341 | Ga0207700_100003416 | 332 |
| 94 | 3300025928 | Ga0207700_10001777 | Ga0207700_1000177710 | 332 |
| 95 | 3300031730 | Ga0307516_10122137 | Ga0307516_101221373 | 332 |
| 96 | 3300031731 | Ga0307405_10243625 | Ga0307405_102436252 | 332 |
| 97 | 3300031852 | Ga0307410_10008063 | Ga0307410_100080636 | 332 |
| 98 | 3300031901 | Ga0307406_10005439 | Ga0307406_100054391 | 332 |
| 99 | 3300031903 | Ga0307407_10022591 | Ga0307407_100225913 | 332 |
| 100 | 3300031911 | Ga0307412_10087104 | Ga0307412_100871043 | 332 |
| 101 | 3300031995 | Ga0307409_100311083 | Ga0307409_1003110832 | 332 |
| 102 | 3300032002 | Ga0307416_100265696 | Ga0307416_1002656962 | 332 |
| 103 | 3300032004 | Ga0307414_10004070 | Ga0307414_100040708 | 332 |
| 104 | 3300032126 | Ga0307415_100000742 | Ga0307415_1000007426 | 332 |
| 105 | 3300035172 | Ga0373955_0001575 | Ga0373955_0001575_1161_2159 | 332 |
| 106 | 3300035695 | Ga0373927_0207697 | Ga0373927_0207697_246_1244 | 332 |
| 107 | 3300036401 | Ga0373937_0055978 | Ga0373937_0055978_686_1684 | 332 |
| 108 | 3300037068 | Ga0373925_0037162 | Ga0373925_0037162_198_1196 | 332 |
| 109 | 3300046683 | Ga0495658_0004322 | Ga0495658_0004322_3526_4524 | 332 |
| 110 | 3300050510 | nmdc:mga06r32_129323_c1 | nmdc:mga06r32_129323_c1_1390_2388 | 332 |
| 111 | 3300026088 | Ga0207641_10138965 | Ga0207641_101389652 | 333 |
| 112 | 3300035111 | Ga0373923_0006028 | Ga0373923_0006028_2615_3637 | 333 |
| 113 | 3300035116 | Ga0373945_0000279 | Ga0373945_0000279_2947_3969 | 333 |
| 114 | 3300035170 | Ga0373943_0084589 | Ga0373943_0084589_507_1529 | 333 |
| 115 | 3300035410 | Ga0373924_0000148 | Ga0373924_0000148_15632_16654 | 333 |
| 116 | 3300035692 | Ga0373935_0000314 | Ga0373935_0000314_9122_10144 | 333 |
| 117 | 3300035695 | Ga0373927_0003000 | Ga0373927_0003000_2274_3296 | 333 |
| 118 | 3300037068 | Ga0373925_0028852 | Ga0373925_0028852_1502_2524 | 333 |
| 119 | 3300046473 | Ga0495582_0067813 | Ga0495582_0067813_313_1335 | 333 |
| 120 | 3300046531 | Ga0495665_0031849 | Ga0495665_0031849_1723_2745 | 333 |
| 121 | 3300046559 | Ga0495667_0014320 | Ga0495667_0014320_2870_3892 | 333 |
| 122 | 3300046663 | Ga0495635_0036152 | Ga0495635_0036152_201_1223 | 333 |
| 123 | 3300047315 | Ga0495581_0092341 | Ga0495581_0092341_353_1375 | 333 |
| 124 | 3300046455 | Ga0495603_0096204 | Ga0495603_0096204_480_1526 | 334 |
| 125 | 3300005355 | Ga0070671_100182929 | Ga0070671_1001829291 | 336 |
| 126 | 3300005441 | Ga0070700_100140624 | Ga0070700_1001406242 | 336 |
| 127 | 3300005545 | Ga0070695_100007105 | Ga0070695_1000071052 | 336 |
| 128 | 3300005548 | Ga0070665_100022332 | Ga0070665_1000223325 | 336 |
| 129 | 3300005719 | Ga0068861_100035388 | Ga0068861_1000353884 | 336 |
| 130 | 3300009177 | Ga0105248_10028223 | Ga0105248_100282238 | 336 |
| 131 | 3300025931 | Ga0207644_10131413 | Ga0207644_101314132 | 336 |
| 132 | 3300025941 | Ga0207711_10149590 | Ga0207711_101495901 | 336 |
| 133 | 3300026075 | Ga0207708_10006032 | Ga0207708_100060327 | 336 |
| 134 | 3300026118 | Ga0207675_100052088 | Ga0207675_1000520883 | 336 |
| 135 | 3300028379 | Ga0268266_10055944 | Ga0268266_100559442 | 336 |
| 136 | 3300035695 | Ga0373927_0004070 | Ga0373927_0004070_4125_5210 | 336 |
| 137 | 3300035725 | Ga0373947_0000124 | Ga0373947_0000124_9611_10696 | 336 |
| 138 | 3300037068 | Ga0373925_0000406 | Ga0373925_0000406_38622_39707 | 336 |
| 139 | 3300025261 | Ga0209233_1000322 | Ga0209233_100032235 | 337 |
| 140 | iso_pu_bacteria | 2585427527 | 2585533081 | 341 |
| 141 | 3300013296 | Ga0157374_10090815 | Ga0157374_100908152 | 343 |
| 142 | 3300025294 | Ga0209025_1030233 | Ga0209025_10302332 | 344 |
| 143 | 3300003214 | JGI25165J46597_1003172 | JGI25165J46597_10031721 | 345 |
| 144 | 3300003323 | rootH1_10217441 | rootH1_1021744110 | 345 |
| 145 | 3300003771 | Ga0055526_1001946 | Ga0055526_100194615 | 345 |
| 146 | 3300003790 | Ga0055528_1001473 | Ga0055528_100147315 | 345 |
| 147 | 3300005543 | Ga0070672_100232847 | Ga0070672_1002328472 | 345 |
| 148 | 3300025253 | Ga0209677_100323 | Ga0209677_10032323 | 345 |
| 149 | 3300025261 | Ga0209233_1000326 | Ga0209233_100032616 | 345 |
| 150 | 3300025273 | Ga0209673_1002190 | Ga0209673_10021905 | 345 |
| 151 | 3300025295 | Ga0209564_1002493 | Ga0209564_10024935 | 345 |
| 152 | 3300025299 | Ga0209256_1002596 | Ga0209256_100259616 | 345 |
| 153 | 3300031616 | Ga0307508_10000701 | Ga0307508_1000070143 | 345 |
| 154 | 3300048929 | Ga0496126_0000485 | Ga0496126_0000485_36139_37176 | 345 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ci0-assembly1.cif.gz_I | the crystal structure of the gspk-gspi-gspj complex from enterotoxigenic escherichia coli type 2 secretion system | 0.5962 | 87 | 115 |
| 8tp6-assembly1.cif.gz_H | h2 hemagglutinin (a/singapore/1/1957) in complex with rbs-targeting fab 4-1-1e02 | 0.48 | 23 | 216 |
| 7cea-assembly1.cif.gz_A | crystal structure of huts-4 fv-clasp fragment | 0.4697 | 23 | 217 |
| 8tp6-assembly1.cif.gz_H | h2 hemagglutinin (a/singapore/1/1957) in complex with rbs-targeting fab 4-1-1e02 | 0.442 | 23 | 216 |
| 4q97-assembly1.cif.gz_B | ignar antibody domain c1 | 0.4397 | 22 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O80701_1_220_1.25.70.10 | Mainly Alpha;Alpha Horseshoe;Transcription termination factor 3, mitochondrial;Transcription termination factor 3, mitochondrial | 0.8202 | 248 | 273 | 1.25.70.10 |
| af_Q58752_1_108_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8141 | 239 | 268 | 1.10.287.70 |
| af_Q9N309_26_518_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6401 | 240 | 269 | 1.20.1250.20 |
| 5cbgC00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.6174 | 220 | 270 | 1.10.287.70 |
| af_Q8NDV3_3_196_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.5621 | 84 | 110 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534ZBY8-F1-model_v4 | DUF4331 domain-containing protein | 0.9675 | 35 | 332 |
|
| AF-A0A534ZBY8-F1-model_v4 | DUF4331 domain-containing protein | 0.961 | 35 | 332 |
|
| AF-A0A535PXZ7-F1-model_v4 | DUF4331 domain-containing protein | 0.9604 | 130 | 333 |
|
| AF-A0A2V8P4R8-F1-model_v4 | DUF4331 domain-containing protein | 0.9568 | 1 | 339 |
|
| AF-A0A2V8PJX2-F1-model_v4 | DUF4331 domain-containing protein | 0.9499 | 162 | 332 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar