F218892

General Info

Members Datasets Scaffolds Average Seq Length
154 120 152 332

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100182929|Ga0070671_1001829291
Length 372
Sequence MIAVNAAAVCAPTPSSEPAHCKGRIDPMSHHYSGPALGFPHGDARLDLTDLYAFGKPGDDRKSILIMNVHPSFSLEPRGPTRSDPFAHEAIYELKIDTDGDSVADIAYRVRFTVFERGAQTATLRCVRGAAAAGVGDTGDVLIEAAPVSLGQTPRITEVGEHRLFAGWRSDPFFFDVLGVLDGFKFSHQDFFADKDVCSIVLEIPNVSLGPGRVGIWARTLDGAGGRWVQADRGARPAQTPFLTGEAIAAYTAAEPVDDRQFVSVFAHSLEHAGGYTPADAERVAATLLPDIMPFDHARPVSYPENGRALTHDTQDHFLSILTNGRVTTDGVGPHSDLLADFPYLGPPHAGVAPFATPPPVPASEATNTNVQ

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
44 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
46 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
47 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 0.65
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.79
Nodule 0.65
Rhizoplane 0.65
Rhizosphere 85.06
Stem 0
Stem Tuber 0
Unclassified 5.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1003172 3300003214 Bacteria 4337
2 rootH1_10217441 3300003323 Bacteria 10456
3 Ga0055526_1001946 3300003771 Bacteria 14296
4 Ga0055528_1001473 3300003790 Bacteria 14311
5 Ga0070660_100042511 3300005339 Bacteria 3469
6 Ga0070671_100182929 3300005355 Bacteria 1775
7 Ga0070659_100013195 3300005366 Bacteria 6145
8 Ga0070713_100000454 3300005436 Bacteria 26216
9 Ga0070713_100086520 3300005436 Bacteria 2687
10 Ga0070700_100140624 3300005441 Bacteria 1640
11 Ga0070681_10259674 3300005458 Bacteria 1649
12 Ga0070706_100090033 3300005467 Bacteria 2845
13 Ga0070698_100005544 3300005471 Bacteria 13794
14 Ga0068853_100343211 3300005539 Bacteria 1388
15 Ga0070672_100232847 3300005543 Bacteria 1548
16 Ga0070695_100007105 3300005545 Bacteria 6636
17 Ga0070665_100022332 3300005548 Bacteria 6368
18 Ga0068855_100000034 3300005563 Bacteria 166436
19 Ga0070664_100192687 3300005564 Bacteria 1816
20 Ga0068852_100001775 3300005616 Bacteria 14678
21 Ga0068861_100035388 3300005719 Bacteria 3699
22 Ga0068861_100378447 3300005719 Bacteria 1250
23 Ga0081540_1098320 3300005983 Bacteria 1267
24 Ga0070717_10001065 3300006028 Bacteria 18424
25 Ga0070715_10062607 3300006163 Bacteria 1638
26 Ga0097621_100314463 3300006237 Bacteria 1386
27 Ga0075431_100390875 3300006847 Unclassified 1393
28 Ga0075431_100551061 3300006847 Bacteria 1140
29 Ga0075433_10014886 3300006852 Bacteria 6366
30 Ga0075434_100007999 3300006871 Bacteria 9802
31 Ga0068865_100089762 3300006881 Bacteria 2227
32 Ga0099794_10032343 3300007265 Unclassified 2455
33 Ga0105240_10000382 3300009093 Bacteria 83108
34 Ga0105240_10001551 3300009093 Bacteria 38976
35 Ga0111539_10069970 3300009094 Bacteria 4143
36 Ga0111539_10432650 3300009094 Bacteria 1532
37 Ga0114129_10098667 3300009147 Bacteria 4043
38 Ga0105248_10000001 3300009177 Bacteria 1881304
39 Ga0105248_10028223 3300009177 Bacteria 6251
40 Ga0105248_10401332 3300009177 Unclassified 1544
41 Ga0105238_10088899 3300009551 Bacteria 3076
42 Ga0105238_10157432 3300009551 Bacteria 2247
43 Ga0105238_10407001 3300009551 Unclassified 1354
44 Ga0099796_10072659 3300010159 Unclassified 1245
45 Ga0105239_10036619 3300010375 Bacteria 5386
46 Ga0105239_10327853 3300010375 Bacteria 1727
47 Ga0157371_10067794 3300013102 Bacteria 2525
48 Ga0157374_10090815 3300013296 Unclassified 2912
49 Ga0157372_10466371 3300013307 Unclassified 1472
50 Ga0157372_10633987 3300013307 Bacteria 1245
51 Ga0163163_10134207 3300014325 Bacteria 2516
52 Ga0213871_10000930 3300021441 Bacteria 4510
53 Ga0209677_100323 3300025253 Bacteria 30849
54 Ga0209759_1010510 3300025256 Bacteria 2708
55 Ga0209233_1000322 3300025261 Bacteria 51917
56 Ga0209233_1000326 3300025261 Bacteria 50250
57 Ga0209673_1002190 3300025273 Bacteria 14364
58 Ga0209025_1030233 3300025294 Bacteria 2598
59 Ga0209564_1002493 3300025295 Bacteria 14353
60 Ga0209256_1002596 3300025299 Bacteria 14339
61 Ga0207684_10000751 3300025910 Bacteria 37862
62 Ga0207707_10208461 3300025912 Bacteria 1703
63 Ga0207695_10000004 3300025913 Bacteria 1288665
64 Ga0207695_10013991 3300025913 Bacteria 9531
65 Ga0207695_10108497 3300025913 Bacteria 2760
66 Ga0207694_10000010 3300025924 Bacteria 439722
67 Ga0207700_10000341 3300025928 Bacteria 27463
68 Ga0207700_10001777 3300025928 Bacteria 12232
69 Ga0207664_10335534 3300025929 Bacteria 1336
70 Ga0207644_10131413 3300025931 Bacteria 1917
71 Ga0207704_10054160 3300025938 Bacteria 2444
72 Ga0207711_10000002 3300025941 Bacteria 1228676
73 Ga0207711_10149590 3300025941 Bacteria 2106
74 Ga0207661_10275088 3300025944 Bacteria 1503
75 Ga0207679_10190065 3300025945 Bacteria 1706
76 Ga0207667_10000065 3300025949 Bacteria 186655
77 Ga0207703_10324341 3300026035 Bacteria 1411
78 Ga0207708_10006032 3300026075 Bacteria 8980
79 Ga0207641_10138965 3300026088 Bacteria 2189
80 Ga0207674_10016378 3300026116 Bacteria 8117
81 Ga0207675_100052088 3300026118 Bacteria 3820
82 Ga0207675_100322910 3300026118 Bacteria 1507
83 Ga0207683_10074910 3300026121 Bacteria 2995
84 Ga0207698_10005454 3300026142 Bacteria 7866
85 Ga0209588_1063667 3300027671 Unclassified 1192
86 Ga0207428_10005645 3300027907 Bacteria 11630
87 Ga0268266_10055944 3300028379 Bacteria 3393
88 Ga0265318_10002500 3300028577 Bacteria 9807
89 Ga0265338_10007789 3300028800 Bacteria 13174
90 Ga0265762_1001333 3300030760 Unclassified 4498
91 Ga0265313_10074246 3300031595 Unclassified 1560
92 Ga0307508_10000701 3300031616 Bacteria 39935
93 Ga0307516_10091501 3300031730 Bacteria 2870
94 Ga0307516_10122137 3300031730 Bacteria 2393
95 Ga0307405_10243625 3300031731 Bacteria 1333
96 Ga0307410_10008063 3300031852 Bacteria 5817
97 Ga0307406_10005439 3300031901 Bacteria 6970
98 Ga0307407_10022591 3300031903 Bacteria 3267
99 Ga0307412_10087104 3300031911 Bacteria 2175
100 Ga0307409_100311083 3300031995 Bacteria 1470
101 Ga0307416_100265696 3300032002 Bacteria 1680
102 Ga0307414_10004070 3300032004 Bacteria 7884
103 Ga0307415_100000742 3300032126 Bacteria 14690
104 Ga0307510_10000003 3300033180 Bacteria 756654
105 Ga0307510_10015859 3300033180 Bacteria 8904
106 Ga0373923_0006028 3300035111 Bacteria 4159
107 Ga0373945_0000279 3300035116 Bacteria 14440
108 Ga0373945_0055116 3300035116 Bacteria 1471
109 Ga0373943_0084589 3300035170 Bacteria 1632
110 Ga0373955_0001575 3300035172 Bacteria 9753
111 Ga0373924_0000148 3300035410 Bacteria 20572
112 Ga0373935_0000314 3300035692 Bacteria 24181
113 Ga0373927_0003000 3300035695 Bacteria 12251
114 Ga0373927_0004070 3300035695 Bacteria 10318
115 Ga0373927_0207697 3300035695 Bacteria 1286
116 Ga0373947_0000124 3300035725 Bacteria 38940
117 Ga0373937_0055978 3300036401 Bacteria 3621
118 Ga0373925_0000406 3300037068 Bacteria 43897
119 Ga0373925_0028852 3300037068 Bacteria 4068
120 Ga0373925_0037162 3300037068 Bacteria 3594
121 Ga0395905_0016798 3300037471 Bacteria 6953
122 Ga0436360_0149002 3300039438 Unclassified 1168
123 Ga0436360_0304671 3300039438 Bacteria 8371
124 Ga0436360_0531402 3300039438 Bacteria 3545
125 Ga0436360_0931190 3300039438 Bacteria 11567
126 Ga0436361_0320433 3300039447 Bacteria 2148
127 Ga0436362_1202203 3300039453 Bacteria 1419
128 Ga0495603_0096204 3300046455 Bacteria 1730
129 Ga0495580_0203564 3300046472 Bacteria 1363
130 Ga0495582_0067813 3300046473 Bacteria 1972
131 Ga0495585_0037526 3300046492 Bacteria 2729
132 Ga0495665_0031849 3300046531 Bacteria 2821
133 Ga0495667_0014320 3300046559 Bacteria 5357
134 Ga0495635_0036152 3300046663 Unclassified 3424
135 Ga0495658_0004322 3300046683 Bacteria 6998
136 Ga0495581_0092341 3300047315 Unclassified 1757
137 Ga0496113_0163191 3300048916 Bacteria 1762
138 Ga0496126_0000485 3300048929 Bacteria 78597
139 Ga0496126_0007358 3300048929 Bacteria 12081
140 nmdc:mga05p37_48397_c1 3300050507 Bacteria 5229
141 nmdc:mga06r32_129323_c1 3300050510 Bacteria 2496
142 nmdc:mga06r32_242193_c1 3300050510 Bacteria 1791
143 nmdc:mga08y16_279119_c1 3300050511 Bacteria 1723
144 nmdc:mga08y16_4664_c1 3300050511 Bacteria 14279
145 nmdc:mga0n895_2340_c1 3300050512 Bacteria 14769
146 nmdc:mga0n895_59720_c1 3300050512 Bacteria 3762
147 nmdc:mga08x19_168701_c1 3300050514 Unclassified 1490
148 nmdc:mga0a205_11452_c1 3300050515 Bacteria 8165
149 nmdc:mga0a205_273705_c1 3300050515 Bacteria 1565
150 nmdc:mga0a205_3740_c1 3300050515 Bacteria 13628
151 Ga0500651_0054631 3300053093 Bacteria 2502
152 Ga0500651_0122560 3300053093 Bacteria 1577

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021441 Ga0213871_10000930 Ga0213871_100009303 282
2 3300046472 Ga0495580_0203564 Ga0495580_0203564_353_1258 294
3 3300039438 Ga0436360_0531402 Ga0436360_0531402_1556_2554 300
4 3300039453 Ga0436362_1202203 Ga0436362_1202203_62_1060 300
5 3300010375 Ga0105239_10327853 Ga0105239_103278532 306
6 3300050510 nmdc:mga06r32_242193_c1 nmdc:mga06r32_242193_c1_858_1781 307
7 3300050515 nmdc:mga0a205_273705_c1 nmdc:mga0a205_273705_c1_46_969 307
8 3300009094 Ga0111539_10432650 Ga0111539_104326501 308
9 3300005563 Ga0068855_100000034 Ga0068855_100000034127 314
10 3300009093 Ga0105240_10000382 Ga0105240_100003827 314
11 3300009177 Ga0105248_10401332 Ga0105248_104013322 314
12 3300025913 Ga0207695_10000004 Ga0207695_100000041105 314
13 3300025949 Ga0207667_10000065 Ga0207667_1000006583 314
14 3300035116 Ga0373945_0055116 Ga0373945_0055116_411_1436 316
15 3300039447 Ga0436361_0320433 Ga0436361_0320433_492_1484 318
16 3300014325 Ga0163163_10134207 Ga0163163_101342073 320
17 3300025256 Ga0209759_1010510 Ga0209759_10105102 320
18 3300005467 Ga0070706_100090033 Ga0070706_1000900334 322
19 3300006028 Ga0070717_10001065 Ga0070717_1000106511 322
20 3300025910 Ga0207684_10000751 Ga0207684_100007513 322
21 iso_pu_bacteria 2503198000 2503202463 322
22 3300005983 Ga0081540_1098320 Ga0081540_10983201 323
23 3300007265 Ga0099794_10032343 Ga0099794_100323433 323
24 3300009551 Ga0105238_10157432 Ga0105238_101574322 323
25 3300013307 Ga0157372_10633987 Ga0157372_106339872 323
26 3300027671 Ga0209588_1063667 Ga0209588_10636672 323
27 3300005339 Ga0070660_100042511 Ga0070660_1000425111 324
28 3300005366 Ga0070659_100013195 Ga0070659_1000131951 324
29 3300005458 Ga0070681_10259674 Ga0070681_102596742 324
30 3300005471 Ga0070698_100005544 Ga0070698_1000055443 324
31 3300005539 Ga0068853_100343211 Ga0068853_1003432112 324
32 3300005564 Ga0070664_100192687 Ga0070664_1001926872 324
33 3300005616 Ga0068852_100001775 Ga0068852_1000017752 324
34 3300006852 Ga0075433_10014886 Ga0075433_100148866 324
35 3300006871 Ga0075434_100007999 Ga0075434_1000079997 324
36 3300009094 Ga0111539_10069970 Ga0111539_100699702 324
37 3300009147 Ga0114129_10098667 Ga0114129_100986676 324
38 3300009177 Ga0105248_10000001 Ga0105248_10000001258 324
39 3300009551 Ga0105238_10088899 Ga0105238_100888992 324
40 3300010375 Ga0105239_10036619 Ga0105239_100366194 324
41 3300013102 Ga0157371_10067794 Ga0157371_100677941 324
42 3300025912 Ga0207707_10208461 Ga0207707_102084612 324
43 3300025913 Ga0207695_10108497 Ga0207695_101084971 324
44 3300025924 Ga0207694_10000010 Ga0207694_10000010143 324
45 3300025941 Ga0207711_10000002 Ga0207711_10000002959 324
46 3300025944 Ga0207661_10275088 Ga0207661_102750882 324
47 3300025945 Ga0207679_10190065 Ga0207679_101900652 324
48 3300026116 Ga0207674_10016378 Ga0207674_100163785 324
49 3300026142 Ga0207698_10005454 Ga0207698_100054543 324
50 3300027907 Ga0207428_10005645 Ga0207428_100056457 324
51 3300031730 Ga0307516_10091501 Ga0307516_100915012 324
52 3300033180 Ga0307510_10000003 Ga0307510_10000003554 324
53 3300033180 Ga0307510_10015859 Ga0307510_100158598 324
54 3300039438 Ga0436360_0149002 Ga0436360_0149002_121_1095 324
55 3300048916 Ga0496113_0163191 Ga0496113_0163191_618_1643 324
56 3300050507 nmdc:mga05p37_48397_c1 nmdc:mga05p37_48397_c1_796_1770 324
57 3300050511 nmdc:mga08y16_279119_c1 nmdc:mga08y16_279119_c1_55_1029 324
58 3300050511 nmdc:mga08y16_4664_c1 nmdc:mga08y16_4664_c1_7344_8318 324
59 3300050512 nmdc:mga0n895_2340_c1 nmdc:mga0n895_2340_c1_12089_13063 324
60 3300050515 nmdc:mga0a205_3740_c1 nmdc:mga0a205_3740_c1_2654_3628 324
61 3300053093 Ga0500651_0054631 Ga0500651_0054631_1458_2432 324
62 3300006163 Ga0070715_10062607 Ga0070715_100626072 325
63 3300028577 Ga0265318_10002500 Ga0265318_100025009 325
64 3300031595 Ga0265313_10074246 Ga0265313_100742462 325
65 3300037471 Ga0395905_0016798 Ga0395905_0016798_2682_3659 325
66 3300006847 Ga0075431_100551061 Ga0075431_1005510612 327
67 3300006881 Ga0068865_100089762 Ga0068865_1000897621 327
68 3300025929 Ga0207664_10335534 Ga0207664_103355342 327
69 3300025938 Ga0207704_10054160 Ga0207704_100541602 327
70 3300026121 Ga0207683_10074910 Ga0207683_100749103 327
71 3300039438 Ga0436360_0304671 Ga0436360_0304671_4438_5430 327
72 3300046492 Ga0495585_0037526 Ga0495585_0037526_418_1401 327
73 3300050512 nmdc:mga0n895_59720_c1 nmdc:mga0n895_59720_c1_2548_3531 327
74 3300050514 nmdc:mga08x19_168701_c1 nmdc:mga08x19_168701_c1_179_1162 327
75 3300050515 nmdc:mga0a205_11452_c1 nmdc:mga0a205_11452_c1_2629_3612 327
76 3300028800 Ga0265338_10007789 Ga0265338_1000778912 328
77 3300053093 Ga0500651_0122560 Ga0500651_0122560_84_1070 328
78 3300030760 Ga0265762_1001333 Ga0265762_10013333 329
79 3300048929 Ga0496126_0007358 Ga0496126_0007358_3770_4759 329
80 3300039438 Ga0436360_0931190 Ga0436360_0931190_9693_10685 330
81 3300005719 Ga0068861_100378447 Ga0068861_1003784471 331
82 3300009093 Ga0105240_10001551 Ga0105240_1000155134 331
83 3300009551 Ga0105238_10407001 Ga0105238_104070012 331
84 3300013307 Ga0157372_10466371 Ga0157372_104663712 331
85 3300025913 Ga0207695_10013991 Ga0207695_100139919 331
86 3300026035 Ga0207703_10324341 Ga0207703_103243411 331
87 3300026118 Ga0207675_100322910 Ga0207675_1003229101 331
88 3300005436 Ga0070713_100000454 Ga0070713_1000004547 332
89 3300005436 Ga0070713_100086520 Ga0070713_1000865202 332
90 3300006237 Ga0097621_100314463 Ga0097621_1003144631 332
91 3300006847 Ga0075431_100390875 Ga0075431_1003908752 332
92 3300010159 Ga0099796_10072659 Ga0099796_100726591 332
93 3300025928 Ga0207700_10000341 Ga0207700_100003416 332
94 3300025928 Ga0207700_10001777 Ga0207700_1000177710 332
95 3300031730 Ga0307516_10122137 Ga0307516_101221373 332
96 3300031731 Ga0307405_10243625 Ga0307405_102436252 332
97 3300031852 Ga0307410_10008063 Ga0307410_100080636 332
98 3300031901 Ga0307406_10005439 Ga0307406_100054391 332
99 3300031903 Ga0307407_10022591 Ga0307407_100225913 332
100 3300031911 Ga0307412_10087104 Ga0307412_100871043 332
101 3300031995 Ga0307409_100311083 Ga0307409_1003110832 332
102 3300032002 Ga0307416_100265696 Ga0307416_1002656962 332
103 3300032004 Ga0307414_10004070 Ga0307414_100040708 332
104 3300032126 Ga0307415_100000742 Ga0307415_1000007426 332
105 3300035172 Ga0373955_0001575 Ga0373955_0001575_1161_2159 332
106 3300035695 Ga0373927_0207697 Ga0373927_0207697_246_1244 332
107 3300036401 Ga0373937_0055978 Ga0373937_0055978_686_1684 332
108 3300037068 Ga0373925_0037162 Ga0373925_0037162_198_1196 332
109 3300046683 Ga0495658_0004322 Ga0495658_0004322_3526_4524 332
110 3300050510 nmdc:mga06r32_129323_c1 nmdc:mga06r32_129323_c1_1390_2388 332
111 3300026088 Ga0207641_10138965 Ga0207641_101389652 333
112 3300035111 Ga0373923_0006028 Ga0373923_0006028_2615_3637 333
113 3300035116 Ga0373945_0000279 Ga0373945_0000279_2947_3969 333
114 3300035170 Ga0373943_0084589 Ga0373943_0084589_507_1529 333
115 3300035410 Ga0373924_0000148 Ga0373924_0000148_15632_16654 333
116 3300035692 Ga0373935_0000314 Ga0373935_0000314_9122_10144 333
117 3300035695 Ga0373927_0003000 Ga0373927_0003000_2274_3296 333
118 3300037068 Ga0373925_0028852 Ga0373925_0028852_1502_2524 333
119 3300046473 Ga0495582_0067813 Ga0495582_0067813_313_1335 333
120 3300046531 Ga0495665_0031849 Ga0495665_0031849_1723_2745 333
121 3300046559 Ga0495667_0014320 Ga0495667_0014320_2870_3892 333
122 3300046663 Ga0495635_0036152 Ga0495635_0036152_201_1223 333
123 3300047315 Ga0495581_0092341 Ga0495581_0092341_353_1375 333
124 3300046455 Ga0495603_0096204 Ga0495603_0096204_480_1526 334
125 3300005355 Ga0070671_100182929 Ga0070671_1001829291 336
126 3300005441 Ga0070700_100140624 Ga0070700_1001406242 336
127 3300005545 Ga0070695_100007105 Ga0070695_1000071052 336
128 3300005548 Ga0070665_100022332 Ga0070665_1000223325 336
129 3300005719 Ga0068861_100035388 Ga0068861_1000353884 336
130 3300009177 Ga0105248_10028223 Ga0105248_100282238 336
131 3300025931 Ga0207644_10131413 Ga0207644_101314132 336
132 3300025941 Ga0207711_10149590 Ga0207711_101495901 336
133 3300026075 Ga0207708_10006032 Ga0207708_100060327 336
134 3300026118 Ga0207675_100052088 Ga0207675_1000520883 336
135 3300028379 Ga0268266_10055944 Ga0268266_100559442 336
136 3300035695 Ga0373927_0004070 Ga0373927_0004070_4125_5210 336
137 3300035725 Ga0373947_0000124 Ga0373947_0000124_9611_10696 336
138 3300037068 Ga0373925_0000406 Ga0373925_0000406_38622_39707 336
139 3300025261 Ga0209233_1000322 Ga0209233_100032235 337
140 iso_pu_bacteria 2585427527 2585533081 341
141 3300013296 Ga0157374_10090815 Ga0157374_100908152 343
142 3300025294 Ga0209025_1030233 Ga0209025_10302332 344
143 3300003214 JGI25165J46597_1003172 JGI25165J46597_10031721 345
144 3300003323 rootH1_10217441 rootH1_1021744110 345
145 3300003771 Ga0055526_1001946 Ga0055526_100194615 345
146 3300003790 Ga0055528_1001473 Ga0055528_100147315 345
147 3300005543 Ga0070672_100232847 Ga0070672_1002328472 345
148 3300025253 Ga0209677_100323 Ga0209677_10032323 345
149 3300025261 Ga0209233_1000326 Ga0209233_100032616 345
150 3300025273 Ga0209673_1002190 Ga0209673_10021905 345
151 3300025295 Ga0209564_1002493 Ga0209564_10024935 345
152 3300025299 Ga0209256_1002596 Ga0209256_100259616 345
153 3300031616 Ga0307508_10000701 Ga0307508_1000070143 345
154 3300048929 Ga0496126_0000485 Ga0496126_0000485_36139_37176 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14224

DUF4331

Domain of unknown function (DUF4331)

144

270

0.82

PF14224

DUF4331

Domain of unknown function (DUF4331)

29

141

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ci0-assembly1.cif.gz_I the crystal structure of the gspk-gspi-gspj complex from enterotoxigenic escherichia coli type 2 secretion system 0.5962 87 115
8tp6-assembly1.cif.gz_H h2 hemagglutinin (a/singapore/1/1957) in complex with rbs-targeting fab 4-1-1e02 0.48 23 216
7cea-assembly1.cif.gz_A crystal structure of huts-4 fv-clasp fragment 0.4697 23 217
8tp6-assembly1.cif.gz_H h2 hemagglutinin (a/singapore/1/1957) in complex with rbs-targeting fab 4-1-1e02 0.442 23 216
4q97-assembly1.cif.gz_B ignar antibody domain c1 0.4397 22 212
ID Description Score Start End Superfamily
af_O80701_1_220_1.25.70.10 Mainly Alpha;Alpha Horseshoe;Transcription termination factor 3, mitochondrial;Transcription termination factor 3, mitochondrial 0.8202 248 273 1.25.70.10
af_Q58752_1_108_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8141 239 268 1.10.287.70
af_Q9N309_26_518_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6401 240 269 1.20.1250.20
5cbgC00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6174 220 270 1.10.287.70
af_Q8NDV3_3_196_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5621 84 110 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A534ZBY8-F1-model_v4 DUF4331 domain-containing protein 0.9675 35 332
AF-A0A534ZBY8-F1-model_v4 DUF4331 domain-containing protein 0.961 35 332
AF-A0A535PXZ7-F1-model_v4 DUF4331 domain-containing protein 0.9604 130 333
AF-A0A2V8P4R8-F1-model_v4 DUF4331 domain-containing protein 0.9568 1 339
AF-A0A2V8PJX2-F1-model_v4 DUF4331 domain-containing protein 0.9499 162 332

Feature Viewer

pLDDT pTM Quality
87.41 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map