F217611

General Info

Members Datasets Scaffolds Average Seq Length
153 119 129 473

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1094199|Ga0436365_1094199_1725_3317
Length 530
Sequence MDLFAAGSFKVSTPHPGSARSSLSAQSLLEPLLGREINAEAVNAIRFASREPSWSLVMLDKPQRAAFLDEIAAIIGARYVLTESSDQAAYLTEMRNMFHGRALAVVRPGTTAEVARVLALASNHRTPVVPQGGNTGLVGGQVPDASGDAIILSLTRLDKVREVDPLSSTMTVEAGLTLLKAQEAAAAADRLFPLSLASEGSCTIGGNLSTNAGGVAVLAYGNARDLVLGLEVALADGRVMDGLSKLRKDNTGYDLKHLFIGAEGTLGVITAAVLKLFPRPTSLATAFCGLSSAEAGLAFLSRMKGGAGSALTTFELIPRIGIDMALRHGQGTRDPLAEPHAWYVLLELSGHSGARVEELAEELIGAAIEAGEVENAVIAASIEQGKALWRIRETIPDAQRAEGVSIKHDISVPVASVPRFIEEADAAVKKLIPGVRTLAFGHVGDGNVHYNVFQQPGTDGAQFLTRWHEIGAVVYEVVTRLGGSISAEHGVGQLKRDLLPRVKDPVALDLMRALKRTLDPQGILNPGKVL

Samples

Sample ID Description Type Environment
1 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
2 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
3 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
4 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
5 2643221641 Nocardioides sp. Root122 Isolate Unclassified
6 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
7 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
8 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
9 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
10 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
11 2739367898 Nocardioides sp. CF479 Isolate Unclassified
12 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
13 2842694124 Methylopila sp. R-72369 Isolate Unclassified
14 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
15 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
16 2909042592 Labrys sp. LIt4 Isolate Nodule
17 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
18 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
19 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
20 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
39 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
43 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
48 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
49 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
50 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
51 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
52 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
53 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
54 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
55 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
56 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
57 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
58 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
59 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
60 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
61 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
62 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
63 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
64 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
65 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
66 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
67 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
68 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
69 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
70 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
71 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
72 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
73 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
74 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
75 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
76 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
77 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
78 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
79 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
80 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
81 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
91 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
92 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
99 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
100 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
101 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
102 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
103 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
104 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
105 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
106 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
107 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
108 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
109 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
110 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
111 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
112 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
113 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
114 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
115 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
116 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
117 641522639 Methylobacterium sp. 4-46 Isolate Nodule
118 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
119 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.31
Metatranscriptomes 0
Isolates 15.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.22
Nodule 3.27
Rhizoplane 5.23
Rhizosphere 39.87
Stem 0
Stem Tuber 0
Unclassified 29.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10116208 3300003323 Bacteria 10197
2 Ga0055536_1009932 3300003781 Bacteria 3859
3 Ga0055531_10003945 3300003794 Bacteria 9214
4 Ga0055531_10015420 3300003794 Bacteria 3369
5 Ga0070717_10033277 3300006028 Bacteria 4159
6 Ga0075365_10077852 3300006038 Bacteria 2241
7 Ga0075369_10017666 3300006186 Bacteria 2896
8 Ga0075431_100000213 3300006847 Bacteria 42816
9 Ga0075429_100003582 3300006880 Bacteria 13236
10 Ga0114129_10000685 3300009147 Bacteria 42795
11 Ga0105237_10038972 3300009545 Bacteria 4798
12 Ga0105238_10059233 3300009551 Bacteria 3836
13 Ga0157369_10037960 3300013105 Bacteria 5269
14 Ga0163163_10003057 3300014325 Bacteria 14159
15 Ga0213876_10000726 3300021384 Bacteria 22935
16 Ga0213876_10001511 3300021384 Bacteria 14407
17 Ga0213876_10011112 3300021384 Bacteria 4816
18 Ga0213875_10000012 3300021388 Bacteria 312017
19 Ga0213875_10001538 3300021388 Bacteria 14813
20 Ga0209676_1000046 3300025292 Bacteria 409173
21 Ga0209676_1001278 3300025292 Bacteria 26066
22 Ga0209564_1000532 3300025295 Bacteria 61903
23 Ga0209564_1015285 3300025295 Bacteria 3132
24 Ga0209758_1008528 3300025297 Bacteria 6608
25 Ga0209050_1009364 3300025298 Bacteria 5023
26 Ga0209257_1000481 3300025304 Bacteria 72432
27 Ga0209257_1000621 3300025304 Bacteria 57292
28 Ga0207695_10112835 3300025913 Bacteria 2695
29 Ga0265328_10000156 3300031239 Bacteria 32024
30 Ga0265328_10020992 3300031239 Bacteria 2496
31 Ga0265331_10000026 3300031250 Bacteria 223760
32 Ga0265327_10029004 3300031251 Bacteria 3153
33 Ga0307406_10006321 3300031901 Bacteria 6534
34 Ga0307412_10008405 3300031911 Bacteria 5890
35 Ga0307412_10093773 3300031911 Bacteria 2107
36 Ga0307414_10014376 3300032004 Bacteria 4744
37 Ga0307414_10049949 3300032004 Bacteria 2895
38 Ga0307414_10053409 3300032004 Bacteria 2817
39 Ga0307414_10168952 3300032004 Bacteria 1746
40 Ga0395900_0125892 3300037418 Bacteria 2628
41 Ga0395900_0154526 3300037418 Bacteria 2344
42 Ga0436364_0223587 3300037853 Bacteria 6724
43 Ga0436364_0415922 3300037853 Bacteria 8626
44 Ga0436364_1464685 3300037853 Bacteria 56214
45 Ga0436365_0241529 3300039437 Bacteria 36438
46 Ga0436365_0738465 3300039437 Bacteria 6123
47 Ga0436365_1094199 3300039437 Bacteria 12500
48 Ga0436365_1598093 3300039437 Bacteria 2427
49 Ga0436363_0471333 3300039450 Bacteria 2759
50 Ga0436363_0702372 3300039450 Bacteria 9845
51 Ga0436363_0738245 3300039450 Bacteria 4307
52 Ga0451576_0001174 3300045051 Bacteria 46946
53 Ga0451576_0045995 3300045051 Bacteria 4596
54 Ga0495641_0047234 3300046461 Bacteria 1977
55 Ga0495606_0000514 3300046507 Bacteria 62799
56 Ga0495632_0060401 3300046519 Bacteria 1842
57 Ga0495648_0001581 3300046524 Bacteria 22185
58 Ga0495633_0005140 3300046558 Bacteria 8108
59 Ga0495667_0044237 3300046559 Bacteria 2950
60 Ga0495625_0043241 3300046660 Bacteria 3268
61 Ga0495661_0022696 3300046665 Bacteria 4081
62 Ga0495613_0000534 3300046689 Bacteria 31677
63 Ga0495624_0059685 3300046690 Bacteria 2393
64 Ga0495649_0000884 3300046694 Bacteria 23959
65 Ga0495600_0070251 3300046809 Bacteria 2288
66 Ga0495676_0133680 3300047321 Bacteria 1787
67 Ga0495686_0027754 3300047472 Bacteria 3693
68 Ga0496104_0023878 3300048907 Bacteria 5623
69 Ga0496108_0005146 3300048911 Bacteria 10572
70 Ga0496109_0013666 3300048912 Bacteria 7051
71 Ga0496112_0005335 3300048915 Bacteria 11098
72 Ga0496113_0001092 3300048916 Bacteria 14692
73 Ga0496115_0026358 3300048918 Bacteria 4536
74 Ga0496115_0192492 3300048918 Bacteria 1685
75 Ga0496116_0016604 3300048919 Bacteria 5752
76 Ga0496117_0048386 3300048920 Bacteria 3038
77 Ga0496118_0065584 3300048921 Bacteria 2656
78 Ga0496121_0002000 3300048924 Bacteria 32381
79 Ga0496121_0059984 3300048924 Bacteria 3133
80 Ga0496122_0002320 3300048925 Bacteria 27466
81 Ga0496123_0001110 3300048926 Bacteria 40337
82 Ga0496125_0000252 3300048928 Bacteria 109988
83 Ga0496125_0003233 3300048928 Bacteria 20087
84 Ga0496125_0006959 3300048928 Bacteria 12113
85 Ga0496125_0009062 3300048928 Bacteria 10300
86 Ga0496126_0061606 3300048929 Bacteria 3370
87 Ga0496126_0069457 3300048929 Bacteria 3142
88 Ga0496126_0145174 3300048929 Bacteria 2039
89 Ga0501032_0000336 3300049569 Bacteria 39319
90 Ga0501033_0000090 3300049570 Bacteria 86596
91 Ga0501034_0000140 3300049571 Bacteria 134996
92 Ga0501036_0000048 3300049572 Bacteria 75517
93 Ga0501036_0078023 3300049572 Bacteria 2802
94 Ga0501037_0000024 3300049573 Bacteria 146046
95 Ga0501038_0000247 3300049574 Bacteria 45720
96 Ga0501039_0000017 3300049575 Bacteria 189412
97 Ga0501039_0033403 3300049575 Bacteria 3967
98 Ga0501043_0000146 3300049579 Bacteria 65887
99 Ga0501046_0020304 3300049580 Bacteria 5497
100 Ga0501070_0141289 3300049586 Bacteria 1988
101 Ga0501071_0178273 3300049587 Bacteria 1592
102 Ga0501073_0016406 3300049589 Bacteria 5368
103 Ga0501035_0000021 3300049822 Bacteria 209085
104 Ga0501044_0018862 3300049823 Bacteria 7386
105 nmdc:mga05p37_4930_c1 3300050507 Bacteria 15634
106 nmdc:mga09592_2669_c1 3300050508 Bacteria 14430
107 nmdc:mga06r32_16352_c1 3300050510 Bacteria 6759
108 nmdc:mga0sz30_13511_c1 3300050516 Bacteria 3199
109 Ga0495612_0027541 3300053078 Bacteria 2286
110 Ga0500644_0015160 3300053088 Bacteria 2190
111 Ga0500566_0002556 3300053094 Bacteria 10823
112 Ga0500650_0002088 3300053098 Bacteria 6431
113 Ga0500556_0000093 3300053104 Bacteria 82933
114 Ga0500572_000637 3300053111 Bacteria 11626
115 Ga0500572_001543 3300053111 Bacteria 6166
116 Ga0500594_0019268 3300053118 Bacteria 1690
117 Ga0500618_001977 3300053125 Bacteria 8391
118 Ga0500642_0000013 3300053130 Bacteria 197927
119 Ga0500652_013742 3300053131 Bacteria 2876
120 Ga0500559_0000226 3300053136 Bacteria 45182
121 Ga0500559_0004207 3300053136 Bacteria 6892
122 Ga0500568_0009120 3300053139 Bacteria 4731
123 Ga0500568_0030253 3300053139 Bacteria 2243
124 Ga0500577_0000970 3300053142 Bacteria 7397
125 Ga0500590_071431 3300053148 Bacteria 1724
126 Ga0500616_0000288 3300053153 Bacteria 73364
127 Ga0500622_0000793 3300053156 Bacteria 27291
128 Ga0500639_016742 3300053163 Bacteria 3866
129 Ga0500596_000691 3300053735 Bacteria 6570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0000534 Ga0495613_0000534_9966_11354 440
2 3300031251 Ga0265327_10029004 Ga0265327_100290044 442
3 3300037418 Ga0395900_0154526 Ga0395900_0154526_674_2053 445
4 3300037418 Ga0395900_0125892 Ga0395900_0125892_844_2223 451
5 3300053078 Ga0495612_0027541 Ga0495612_0027541_775_2205 451
6 3300014325 Ga0163163_10003057 Ga0163163_100030575 453
7 3300046461 Ga0495641_0047234 Ga0495641_0047234_494_1906 453
8 3300046690 Ga0495624_0059685 Ga0495624_0059685_286_1698 453
9 3300047321 Ga0495676_0133680 Ga0495676_0133680_250_1662 453
10 3300048907 Ga0496104_0023878 Ga0496104_0023878_1994_3406 453
11 3300048911 Ga0496108_0005146 Ga0496108_0005146_5702_7114 453
12 3300048912 Ga0496109_0013666 Ga0496109_0013666_3745_5157 453
13 3300048915 Ga0496112_0005335 Ga0496112_0005335_4115_5527 453
14 3300048916 Ga0496113_0001092 Ga0496113_0001092_6929_8341 453
15 3300048918 Ga0496115_0026358 Ga0496115_0026358_2935_4347 453
16 3300053094 Ga0500566_0002556 Ga0500566_0002556_1240_2697 454
17 3300053136 Ga0500559_0004207 Ga0500559_0004207_1986_3443 454
18 3300049572 Ga0501036_0078023 Ga0501036_0078023_95_1504 455
19 3300049575 Ga0501039_0033403 Ga0501039_0033403_131_1540 455
20 3300049587 Ga0501071_0178273 Ga0501071_0178273_74_1483 455
21 3300031911 Ga0307412_10093773 Ga0307412_100937732 456
22 3300053111 Ga0500572_001543 Ga0500572_001543_617_1996 456
23 3300053148 Ga0500590_071431 Ga0500590_071431_17_1396 456
24 3300046507 Ga0495606_0000514 Ga0495606_0000514_41987_43408 458
25 3300048920 Ga0496117_0048386 Ga0496117_0048386_745_2190 463
26 3300048929 Ga0496126_0061606 Ga0496126_0061606_1225_2670 463
27 iso_pu_bacteria 2941485952 2941487469 463
28 3300006028 Ga0070717_10033277 Ga0070717_100332776 464
29 3300048928 Ga0496125_0000252 Ga0496125_0000252_18569_20014 464
30 iso_pu_bacteria 2643221574 2643883601 464
31 iso_pu_bacteria 2643221663 2644354255 464
32 iso_pu_bacteria 2643221699 2644551862 464
33 iso_pu_bacteria 2643221699 2644553105 464
34 iso_pu_bacteria 2840878972 2840879059 465
35 3300031239 Ga0265328_10000156 Ga0265328_1000015623 466
36 3300045051 Ga0451576_0001174 Ga0451576_0001174_16234_17643 466
37 iso_pu_bacteria 2643221641 2644228321 466
38 iso_pu_bacteria 2928972540 2928975067 466
39 3300003794 Ga0055531_10003945 Ga0055531_100039457 467
40 3300025298 Ga0209050_1009364 Ga0209050_10093642 467
41 3300025304 Ga0209257_1000621 Ga0209257_100062120 467
42 3300048919 Ga0496116_0016604 Ga0496116_0016604_4199_5602 467
43 3300048928 Ga0496125_0006959 Ga0496125_0006959_3741_5144 467
44 iso_pu_bacteria 2545555834 2545674808 467
45 iso_pu_bacteria 2739367898 2740165821 467
46 iso_pu_bacteria 2842694124 2842698055 467
47 iso_pu_bacteria 2909042592 2909045157 467
48 iso_pu_bacteria 3003665799 3003665945 467
49 iso_pu_bacteria 641522639 641645139 467
50 iso_pu_bacteria 643348564 643602940 467
51 3300003781 Ga0055536_1009932 Ga0055536_10099323 468
52 3300003794 Ga0055531_10015420 Ga0055531_100154203 468
53 3300021384 Ga0213876_10000726 Ga0213876_1000072610 468
54 3300021384 Ga0213876_10001511 Ga0213876_1000151111 468
55 3300021388 Ga0213875_10001538 Ga0213875_1000153810 468
56 3300025292 Ga0209676_1000046 Ga0209676_1000046163 468
57 3300025292 Ga0209676_1001278 Ga0209676_100127811 468
58 3300025304 Ga0209257_1000481 Ga0209257_100048170 468
59 3300031901 Ga0307406_10006321 Ga0307406_100063212 468
60 3300031911 Ga0307412_10008405 Ga0307412_100084054 468
61 3300032004 Ga0307414_10014376 Ga0307414_100143762 468
62 3300032004 Ga0307414_10053409 Ga0307414_100534092 468
63 3300032004 Ga0307414_10168952 Ga0307414_101689522 468
64 3300037853 Ga0436364_0223587 Ga0436364_0223587_1204_2625 468
65 3300037853 Ga0436364_0415922 Ga0436364_0415922_771_2183 468
66 3300039437 Ga0436365_0241529 Ga0436365_0241529_25249_26670 468
67 3300039437 Ga0436365_1094199 Ga0436365_1094199_1725_3317 468
68 3300039437 Ga0436365_1598093 Ga0436365_1598093_481_1902 468
69 3300039450 Ga0436363_0471333 Ga0436363_0471333_932_2353 468
70 3300039450 Ga0436363_0738245 Ga0436363_0738245_1103_2524 468
71 3300046694 Ga0495649_0000884 Ga0495649_0000884_13599_15005 468
72 3300048918 Ga0496115_0192492 Ga0496115_0192492_178_1584 468
73 3300053088 Ga0500644_0015160 Ga0500644_0015160_147_1553 468
74 iso_pu_bacteria 2738541281 2738746629 468
75 iso_pu_bacteria 2738543032 2739355859 468
76 iso_pu_bacteria 8054609563 8054609641 468
77 3300013105 Ga0157369_10037960 Ga0157369_100379603 469
78 3300032004 Ga0307414_10049949 Ga0307414_100499493 469
79 3300046558 Ga0495633_0005140 Ga0495633_0005140_2146_3558 469
80 3300048925 Ga0496122_0002320 Ga0496122_0002320_11754_13166 469
81 3300048926 Ga0496123_0001110 Ga0496123_0001110_15811_17223 469
82 3300049589 Ga0501073_0016406 Ga0501073_0016406_3166_4587 469
83 3300021384 Ga0213876_10011112 Ga0213876_100111125 470
84 3300021388 Ga0213875_10000012 Ga0213875_10000012146 470
85 3300031239 Ga0265328_10020992 Ga0265328_100209922 470
86 3300031250 Ga0265331_10000026 Ga0265331_10000026158 470
87 3300037853 Ga0436364_1464685 Ga0436364_1464685_13048_14484 470
88 3300039437 Ga0436365_0738465 Ga0436365_0738465_1160_2596 470
89 3300045051 Ga0451576_0045995 Ga0451576_0045995_2915_4402 470
90 3300048929 Ga0496126_0145174 Ga0496126_0145174_548_1975 470
91 3300049586 Ga0501070_0141289 Ga0501070_0141289_479_1915 470
92 3300053111 Ga0500572_000637 Ga0500572_000637_6200_7627 470
93 3300053136 Ga0500559_0000226 Ga0500559_0000226_23793_25220 470
94 3300053163 Ga0500639_016742 Ga0500639_016742_1550_2977 470
95 3300053735 Ga0500596_000691 Ga0500596_000691_3444_4871 470
96 iso_pu_bacteria 2523231067 2523466383 470
97 iso_pu_bacteria 2602042107 2603857632 470
98 iso_pu_bacteria 2738543031 2739350645 470
99 iso_pu_bacteria 2857524615 2857526999 470
100 iso_pu_bacteria 2893066018 2893068219 470
101 iso_pu_bacteria 2919073203 2919078111 470
102 3300006847 Ga0075431_100000213 Ga0075431_10000021341 471
103 3300006880 Ga0075429_100003582 Ga0075429_10000358211 471
104 3300009147 Ga0114129_10000685 Ga0114129_100006855 471
105 3300039450 Ga0436363_0702372 Ga0436363_0702372_3457_4893 471
106 3300049569 Ga0501032_0000336 Ga0501032_0000336_7922_9355 471
107 3300049570 Ga0501033_0000090 Ga0501033_0000090_63770_65203 471
108 3300049571 Ga0501034_0000140 Ga0501034_0000140_101657_103090 471
109 3300049572 Ga0501036_0000048 Ga0501036_0000048_45882_47315 471
110 3300049573 Ga0501037_0000024 Ga0501037_0000024_51373_52806 471
111 3300049574 Ga0501038_0000247 Ga0501038_0000247_36366_37799 471
112 3300049575 Ga0501039_0000017 Ga0501039_0000017_151614_153047 471
113 3300049579 Ga0501043_0000146 Ga0501043_0000146_29965_31398 471
114 3300049580 Ga0501046_0020304 Ga0501046_0020304_1271_2704 471
115 3300049822 Ga0501035_0000021 Ga0501035_0000021_56051_57484 471
116 3300049823 Ga0501044_0018862 Ga0501044_0018862_2586_4019 471
117 3300050507 nmdc:mga05p37_4930_c1 nmdc:mga05p37_4930_c1_3105_4535 471
118 3300050508 nmdc:mga09592_2669_c1 nmdc:mga09592_2669_c1_11874_13304 471
119 3300050510 nmdc:mga06r32_16352_c1 nmdc:mga06r32_16352_c1_2220_3650 471
120 3300009545 Ga0105237_10038972 Ga0105237_100389727 472
121 3300009551 Ga0105238_10059233 Ga0105238_100592335 472
122 3300025297 Ga0209758_1008528 Ga0209758_10085285 473
123 3300048924 Ga0496121_0059984 Ga0496121_0059984_517_1956 473
124 3300006038 Ga0075365_10077852 Ga0075365_100778523 474
125 3300006186 Ga0075369_10017666 Ga0075369_100176662 474
126 3300025295 Ga0209564_1000532 Ga0209564_100053256 474
127 3300025295 Ga0209564_1015285 Ga0209564_10152851 474
128 3300046519 Ga0495632_0060401 Ga0495632_0060401_169_1626 474
129 3300046524 Ga0495648_0001581 Ga0495648_0001581_17478_18923 474
130 3300046559 Ga0495667_0044237 Ga0495667_0044237_964_2409 474
131 3300046660 Ga0495625_0043241 Ga0495625_0043241_1085_2542 474
132 3300046665 Ga0495661_0022696 Ga0495661_0022696_1118_2575 474
133 3300046809 Ga0495600_0070251 Ga0495600_0070251_197_1642 474
134 3300047472 Ga0495686_0027754 Ga0495686_0027754_2179_3636 474
135 3300048921 Ga0496118_0065584 Ga0496118_0065584_377_1834 474
136 3300048924 Ga0496121_0002000 Ga0496121_0002000_24329_25786 474
137 3300048928 Ga0496125_0003233 Ga0496125_0003233_17475_18932 474
138 3300048928 Ga0496125_0009062 Ga0496125_0009062_5318_6763 474
139 3300048929 Ga0496126_0069457 Ga0496126_0069457_1471_2916 474
140 3300050516 nmdc:mga0sz30_13511_c1 nmdc:mga0sz30_13511_c1_529_1986 474
141 3300053098 Ga0500650_0002088 Ga0500650_0002088_174_1631 474
142 3300053104 Ga0500556_0000093 Ga0500556_0000093_33726_35183 474
143 3300053118 Ga0500594_0019268 Ga0500594_0019268_138_1583 474
144 3300053125 Ga0500618_001977 Ga0500618_001977_4522_5952 474
145 3300053130 Ga0500642_0000013 Ga0500642_0000013_38854_40311 474
146 3300053131 Ga0500652_013742 Ga0500652_013742_229_1686 474
147 3300053139 Ga0500568_0009120 Ga0500568_0009120_1788_3245 474
148 3300053139 Ga0500568_0030253 Ga0500568_0030253_370_1815 474
149 3300053142 Ga0500577_0000970 Ga0500577_0000970_5819_7264 474
150 3300053153 Ga0500616_0000288 Ga0500616_0000288_34214_35671 474
151 3300053156 Ga0500622_0000793 Ga0500622_0000793_21066_22523 474
152 3300025913 Ga0207695_10112835 Ga0207695_101128352 477
153 3300003323 rootH1_10116208 rootH1_101162082 481

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01565

FAD_binding_4

FAD binding domain

102

242

0.97

PF02913

FAD-oxidase_C

FAD linked oxidases, C-terminal domain

279

529

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pm9-assembly1.cif.gz_A crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution 0.9841 7 477
3pm9-assembly1.cif.gz_A crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution 0.9778 7 477
7qh2-assembly1.cif.gz_F cryo-em structure of ldh-etfab complex from acetobacterium woodii 0.9394 1 479
7qh2-assembly1.cif.gz_F cryo-em structure of ldh-etfab complex from acetobacterium woodii 0.9355 1 479
6lpq-assembly1.cif.gz_A crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) 0.933 1 478
ID Description Score Start End Superfamily
3pm9F02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9918 102 222 3.30.465.10
3pm9F02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9755 102 222 3.30.465.10
af_K7K4A7_263_384_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9749 102 222 3.30.465.10
af_O07406_91_210_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9735 102 221 3.30.465.10
af_Q4D224_129_228_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9704 105 203 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A6N9BBE1-F1-model_v4 FAD-binding oxidoreductase 0.9879 9 357 GO:0003824
GO:0022904
GO:0071949
AF-A0A3D5DF42-F1-model_v4 Hydroxyacid dehydrogenase 0.9848 7 477 GO:0003824
GO:0022904
GO:0071949
AF-A0A7Y3J612-F1-model_v4 FAD-binding oxidoreductase 0.9839 97 478 GO:0003824
GO:0022904
GO:0071949
AF-A0A1Q3KBH5-F1-model_v4 Hydroxyacid dehydrogenase 0.9832 60 478 GO:0003824
GO:0022904
GO:0071949
AF-A0A3D5DF42-F1-model_v4 Hydroxyacid dehydrogenase 0.9827 7 477 GO:0003824
GO:0022904
GO:0071949

Feature Viewer

pLDDT pTM Quality
93.44 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map