F217602

General Info

Members Datasets Scaffolds Average Seq Length
153 78 152 146

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0970998|Ga0395901_0970998_312_803
Length 163
Sequence VSDDELVHQRVFRAPRELVWRCLTEPAELAAFWGPRGMTTPLDGIVVELREGGRFETLMVGEHGSYRMVARFTEVVPPERLAWIEPASGMHTTNTLVDLGDGGTEVVIHQRHVPEPMRSPEARAGFLTSLDKLEEHLARPGTRARLTRELDRPDSPNDPRGRP

Samples

Sample ID Description Type Environment
1 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
27 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
57 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
60 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
61 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
62 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
65 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
66 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
67 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
70 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
71 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
72 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
73 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
75 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
77 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
78 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 2.61
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.27
Rhizosphere 96.08
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10020274 3300003320 Bacteria 4190
2 Ga0070658_10660883 3300005327 Bacteria 907
3 Ga0070682_100098615 3300005337 Bacteria 1925
4 Ga0070659_100416949 3300005366 Bacteria 1135
5 Ga0070714_100009814 3300005435 Bacteria 7546
6 Ga0070714_100650491 3300005435 Bacteria 1015
7 Ga0070713_101343119 3300005436 Bacteria 693
8 Ga0070710_10010663 3300005437 Bacteria 4519
9 Ga0070711_100126338 3300005439 Bacteria 1899
10 Ga0070700_100000003 3300005441 Bacteria 261247
11 Ga0070678_100644226 3300005456 Bacteria 950
12 Ga0070662_101276077 3300005457 Bacteria 632
13 Ga0070679_100022892 3300005530 Bacteria 6111
14 Ga0070679_100229755 3300005530 Bacteria 1815
15 Ga0070665_100446379 3300005548 Bacteria 1303
16 Ga0070664_100884126 3300005564 Bacteria 837
17 Ga0068856_100085538 3300005614 Bacteria 3132
18 Ga0070717_10161546 3300006028 Bacteria 1944
19 Ga0070712_100189071 3300006175 Bacteria 1610
20 Ga0070712_101302793 3300006175 Bacteria 633
21 Ga0105242_11612964 3300009176 Bacteria 683
22 Ga0105237_11277375 3300009545 Bacteria 740
23 Ga0105238_10100975 3300009551 Bacteria 2868
24 Ga0157371_11571207 3300013102 Bacteria 514
25 Ga0157369_10030265 3300013105 Bacteria 5973
26 Ga0157369_10230226 3300013105 Bacteria 1938
27 Ga0157372_10049615 3300013307 Bacteria 4668
28 Ga0157372_10854668 3300013307 Bacteria 1056
29 Ga0157372_11296443 3300013307 Bacteria 840
30 Ga0157380_11479608 3300014326 Bacteria 732
31 Ga0157377_10326885 3300014745 Bacteria 1021
32 Ga0206356_10311854 3300020070 Bacteria 787
33 Ga0206353_10321080 3300020082 Bacteria 796
34 Ga0206353_11278172 3300020082 Bacteria 5014
35 Ga0207692_10204305 3300025898 Bacteria 1163
36 Ga0207699_10131581 3300025906 Bacteria 1632
37 Ga0207654_10369522 3300025911 Bacteria 991
38 Ga0207707_10752671 3300025912 Unclassified 815
39 Ga0207693_10149512 3300025915 Bacteria 1837
40 Ga0207663_10065192 3300025916 Bacteria 2327
41 Ga0207652_10157931 3300025921 Bacteria 2032
42 Ga0207687_10676734 3300025927 Bacteria 874
43 Ga0207664_10107446 3300025929 Bacteria 2315
44 Ga0207706_11038350 3300025933 Bacteria 687
45 Ga0207686_10767299 3300025934 Bacteria 771
46 Ga0207665_10331001 3300025939 Bacteria 1145
47 Ga0207679_10475151 3300025945 Bacteria 1112
48 Ga0207640_11325054 3300025981 Bacteria 643
49 Ga0207678_10308745 3300026067 Bacteria 1360
50 Ga0207708_10000002 3300026075 Bacteria 411071
51 Ga0207702_10186879 3300026078 Bacteria 1911
52 Ga0207702_11839611 3300026078 Bacteria 597
53 Ga0207698_10310858 3300026142 Bacteria 1471
54 Ga0207698_11556651 3300026142 Bacteria 676
55 Ga0307405_10166588 3300031731 Bacteria 1567
56 Ga0307405_10738214 3300031731 Bacteria 819
57 Ga0307407_10128422 3300031903 Bacteria 1618
58 Ga0307407_10489810 3300031903 Bacteria 899
59 Ga0307407_11659742 3300031903 Bacteria 508
60 Ga0307409_100172794 3300031995 Bacteria 1904
61 Ga0307409_100365739 3300031995 Bacteria 1366
62 Ga0307416_101030973 3300032002 Bacteria 926
63 Ga0307416_103079744 3300032002 Bacteria 558
64 Ga0307415_100442557 3300032126 Bacteria 1121
65 Ga0395899_0813594 3300037312 Bacteria 576
66 Ga0395900_0135473 3300037418 Bacteria 2523
67 Ga0395900_0162434 3300037418 Bacteria 2278
68 Ga0395898_0133625 3300037466 Bacteria 2376
69 Ga0395898_0274259 3300037466 Bacteria 1609
70 Ga0395901_0114429 3300038443 Bacteria 2834
71 Ga0395901_0264609 3300038443 Bacteria 1789
72 Ga0395901_0786365 3300038443 Bacteria 942
73 Ga0395901_0970998 3300038443 Bacteria 827
74 Ga0451793_0994697 3300041452 Bacteria 705
75 Ga0466965_0048429 3300044683 Bacteria 2106
76 Ga0466965_0138422 3300044683 Bacteria 1266
77 Ga0466965_0147061 3300044683 Bacteria 1230
78 Ga0466965_0306663 3300044683 Bacteria 862
79 Ga0466965_0779621 3300044683 Bacteria 552
80 Ga0466966_0075377 3300044684 Bacteria 2108
81 Ga0466966_0109186 3300044684 Bacteria 1706
82 Ga0466966_0226949 3300044684 Bacteria 1127
83 Ga0466966_0270016 3300044684 Bacteria 1023
84 Ga0466966_0652196 3300044684 Bacteria 634
85 Ga0466961_0092211 3300044693 Bacteria 1912
86 Ga0466961_0431933 3300044693 Bacteria 798
87 Ga0466961_0695644 3300044693 Bacteria 609
88 Ga0466963_0146281 3300044694 Bacteria 1640
89 Ga0466963_0250685 3300044694 Bacteria 1242
90 Ga0466963_0546823 3300044694 Bacteria 818
91 Ga0466964_0142124 3300044706 Bacteria 1104
92 Ga0466964_0401585 3300044706 Bacteria 716
93 Ga0466971_0027718 3300044719 Bacteria 2537
94 Ga0466971_0247835 3300044719 Bacteria 848
95 Ga0466971_0275902 3300044719 Bacteria 804
96 Ga0466970_0037211 3300044765 Bacteria 2579
97 Ga0466970_0076573 3300044765 Bacteria 1803
98 Ga0466957_0018000 3300044842 Bacteria 4144
99 Ga0466957_0037376 3300044842 Bacteria 2923
100 Ga0466957_0103237 3300044842 Bacteria 1800
101 Ga0466957_0123081 3300044842 Bacteria 1655
102 Ga0466957_0132231 3300044842 Bacteria 1600
103 Ga0466957_0380119 3300044842 Bacteria 963
104 Ga0466957_0412891 3300044842 Bacteria 925
105 Ga0466957_0633505 3300044842 Bacteria 751
106 Ga0466957_0921273 3300044842 Bacteria 625
107 Ga0466960_0005472 3300044901 Bacteria 5034
108 Ga0466960_0054588 3300044901 Bacteria 1940
109 Ga0466960_0093825 3300044901 Bacteria 1534
110 Ga0466960_0115408 3300044901 Bacteria 1400
111 Ga0466960_0187298 3300044901 Bacteria 1125
112 Ga0466960_0404631 3300044901 Bacteria 787
113 Ga0466960_0642342 3300044901 Bacteria 633
114 Ga0466959_0041322 3300045049 Bacteria 3404
115 Ga0466959_0096572 3300045049 Bacteria 2118
116 Ga0466959_0274188 3300045049 Bacteria 1159
117 Ga0466959_0374885 3300045049 Bacteria 969
118 Ga0466959_0388268 3300045049 Bacteria 950
119 Ga0466959_0428629 3300045049 Bacteria 897
120 Ga0466958_0009573 3300045836 Bacteria 5404
121 Ga0466958_0057070 3300045836 Bacteria 2373
122 Ga0466958_0087038 3300045836 Bacteria 1929
123 Ga0466958_0226511 3300045836 Bacteria 1193
124 Ga0466958_0272680 3300045836 Bacteria 1084
125 Ga0466958_0285166 3300045836 Bacteria 1059
126 Ga0466958_0357560 3300045836 Bacteria 941
127 Ga0466958_0649940 3300045836 Bacteria 686
128 Ga0466967_0002638 3300045976 Bacteria 11299
129 Ga0466967_0032115 3300045976 Bacteria 4429
130 Ga0466967_0096782 3300045976 Bacteria 2693
131 Ga0466967_0113994 3300045976 Bacteria 2488
132 Ga0466967_0228910 3300045976 Bacteria 1769
133 Ga0466967_0377561 3300045976 Bacteria 1376
134 Ga0466967_0695143 3300045976 Bacteria 1007
135 Ga0466967_0849986 3300045976 Bacteria 907
136 Ga0466967_1103344 3300045976 Bacteria 791
137 Ga0466967_1230524 3300045976 Bacteria 746
138 Ga0466967_1455450 3300045976 Bacteria 682
139 Ga0466967_1647057 3300045976 Bacteria 639
140 Ga0466967_1696454 3300045976 Bacteria 629
141 Ga0496102_0649946 3300048905 Bacteria 978
142 Ga0496106_1092983 3300048909 Bacteria 625
143 Ga0496112_0627814 3300048915 Bacteria 1005
144 Ga0496113_0559677 3300048916 Bacteria 917
145 Ga0501317_096085 3300049533 Bacteria 529
146 Ga0501224_085485 3300049664 Bacteria 506
147 Ga0501035_0030346 3300049822 Bacteria 4929
148 Ga0501044_0390176 3300049823 Bacteria 1306
149 Ga0466962_0067280 3300061719 Bacteria 1710
150 Ga0466962_0097820 3300061719 Bacteria 1408
151 Ga0466962_0602212 3300061719 Bacteria 560
152 Ga0530510_0548297 3300061734 Bacteria 878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0695644 Ga0466961_0695644_189_599 136
2 3300009176 Ga0105242_11612964 Ga0105242_116129642 139
3 3300025934 Ga0207686_10767299 Ga0207686_107672992 139
4 iso_pu_bacteria 2919446982 2919450591 142
5 3300013105 Ga0157369_10230226 Ga0157369_102302263 143
6 3300005337 Ga0070682_100098615 Ga0070682_1000986153 144
7 3300005366 Ga0070659_100416949 Ga0070659_1004169492 144
8 3300005530 Ga0070679_100229755 Ga0070679_1002297553 144
9 3300009545 Ga0105237_11277375 Ga0105237_112773752 144
10 3300009551 Ga0105238_10100975 Ga0105238_101009755 144
11 3300020082 Ga0206353_10321080 Ga0206353_103210802 144
12 3300025911 Ga0207654_10369522 Ga0207654_103695222 144
13 3300025945 Ga0207679_10475151 Ga0207679_104751512 144
14 3300026078 Ga0207702_11839611 Ga0207702_118396111 144
15 3300026142 Ga0207698_10310858 Ga0207698_103108582 144
16 3300037466 Ga0395898_0274259 Ga0395898_0274259_968_1405 144
17 3300038443 Ga0395901_0786365 Ga0395901_0786365_461_895 144
18 3300044683 Ga0466965_0138422 Ga0466965_0138422_509_943 144
19 3300045976 Ga0466967_0695143 Ga0466967_0695143_18_452 144
20 3300045976 Ga0466967_1103344 Ga0466967_1103344_290_724 144
21 3300048915 Ga0496112_0627814 Ga0496112_0627814_34_468 144
22 3300048916 Ga0496113_0559677 Ga0496113_0559677_398_832 144
23 3300005530 Ga0070679_100022892 Ga0070679_1000228926 145
24 3300005548 Ga0070665_100446379 Ga0070665_1004463792 145
25 3300020070 Ga0206356_10311854 Ga0206356_103118541 145
26 3300020082 Ga0206353_11278172 Ga0206353_112781723 145
27 3300025921 Ga0207652_10157931 Ga0207652_101579312 145
28 3300044842 Ga0466957_0380119 Ga0466957_0380119_142_579 145
29 3300003320 rootH2_10020274 rootH2_100202747 146
30 3300005327 Ga0070658_10660883 Ga0070658_106608832 146
31 3300005435 Ga0070714_100009814 Ga0070714_1000098143 146
32 3300005435 Ga0070714_100650491 Ga0070714_1006504912 146
33 3300005436 Ga0070713_101343119 Ga0070713_1013431191 146
34 3300005437 Ga0070710_10010663 Ga0070710_100106633 146
35 3300005439 Ga0070711_100126338 Ga0070711_1001263382 146
36 3300005441 Ga0070700_100000003 Ga0070700_10000000315 146
37 3300005456 Ga0070678_100644226 Ga0070678_1006442262 146
38 3300005457 Ga0070662_101276077 Ga0070662_1012760772 146
39 3300005564 Ga0070664_100884126 Ga0070664_1008841262 146
40 3300005614 Ga0068856_100085538 Ga0068856_1000855385 146
41 3300006028 Ga0070717_10161546 Ga0070717_101615462 146
42 3300006175 Ga0070712_100189071 Ga0070712_1001890712 146
43 3300006175 Ga0070712_101302793 Ga0070712_1013027931 146
44 3300013102 Ga0157371_11571207 Ga0157371_115712071 146
45 3300013105 Ga0157369_10030265 Ga0157369_100302659 146
46 3300013307 Ga0157372_10049615 Ga0157372_100496152 146
47 3300013307 Ga0157372_10854668 Ga0157372_108546682 146
48 3300013307 Ga0157372_11296443 Ga0157372_112964432 146
49 3300014326 Ga0157380_11479608 Ga0157380_114796082 146
50 3300014745 Ga0157377_10326885 Ga0157377_103268852 146
51 3300025898 Ga0207692_10204305 Ga0207692_102043052 146
52 3300025906 Ga0207699_10131581 Ga0207699_101315812 146
53 3300025912 Ga0207707_10752671 Ga0207707_107526712 146
54 3300025915 Ga0207693_10149512 Ga0207693_101495122 146
55 3300025916 Ga0207663_10065192 Ga0207663_100651923 146
56 3300025927 Ga0207687_10676734 Ga0207687_106767342 146
57 3300025929 Ga0207664_10107446 Ga0207664_101074463 146
58 3300025933 Ga0207706_11038350 Ga0207706_110383502 146
59 3300025939 Ga0207665_10331001 Ga0207665_103310012 146
60 3300025981 Ga0207640_11325054 Ga0207640_113250542 146
61 3300026067 Ga0207678_10308745 Ga0207678_103087452 146
62 3300026075 Ga0207708_10000002 Ga0207708_10000002155 146
63 3300026078 Ga0207702_10186879 Ga0207702_101868792 146
64 3300026142 Ga0207698_11556651 Ga0207698_115566511 146
65 3300031731 Ga0307405_10166588 Ga0307405_101665883 146
66 3300031731 Ga0307405_10738214 Ga0307405_107382142 146
67 3300031903 Ga0307407_10128422 Ga0307407_101284223 146
68 3300031903 Ga0307407_10489810 Ga0307407_104898102 146
69 3300031903 Ga0307407_11659742 Ga0307407_116597421 146
70 3300031995 Ga0307409_100172794 Ga0307409_1001727942 146
71 3300031995 Ga0307409_100365739 Ga0307409_1003657392 146
72 3300032002 Ga0307416_101030973 Ga0307416_1010309732 146
73 3300032002 Ga0307416_103079744 Ga0307416_1030797441 146
74 3300032126 Ga0307415_100442557 Ga0307415_1004425572 146
75 3300037312 Ga0395899_0813594 Ga0395899_0813594_20_460 146
76 3300037418 Ga0395900_0135473 Ga0395900_0135473_1566_2006 146
77 3300037418 Ga0395900_0162434 Ga0395900_0162434_1349_1789 146
78 3300037466 Ga0395898_0133625 Ga0395898_0133625_1451_1891 146
79 3300038443 Ga0395901_0114429 Ga0395901_0114429_974_1414 146
80 3300038443 Ga0395901_0264609 Ga0395901_0264609_708_1148 146
81 3300038443 Ga0395901_0970998 Ga0395901_0970998_312_803 146
82 3300041452 Ga0451793_0994697 Ga0451793_0994697_139_579 146
83 3300044683 Ga0466965_0048429 Ga0466965_0048429_1069_1509 146
84 3300044683 Ga0466965_0147061 Ga0466965_0147061_109_552 146
85 3300044683 Ga0466965_0306663 Ga0466965_0306663_221_664 146
86 3300044683 Ga0466965_0779621 Ga0466965_0779621_89_529 146
87 3300044684 Ga0466966_0075377 Ga0466966_0075377_385_825 146
88 3300044684 Ga0466966_0109186 Ga0466966_0109186_200_640 146
89 3300044684 Ga0466966_0226949 Ga0466966_0226949_109_558 146
90 3300044684 Ga0466966_0270016 Ga0466966_0270016_291_734 146
91 3300044684 Ga0466966_0652196 Ga0466966_0652196_48_488 146
92 3300044693 Ga0466961_0092211 Ga0466961_0092211_886_1326 146
93 3300044693 Ga0466961_0431933 Ga0466961_0431933_159_599 146
94 3300044694 Ga0466963_0146281 Ga0466963_0146281_702_1142 146
95 3300044694 Ga0466963_0250685 Ga0466963_0250685_513_953 146
96 3300044694 Ga0466963_0546823 Ga0466963_0546823_196_639 146
97 3300044706 Ga0466964_0142124 Ga0466964_0142124_380_820 146
98 3300044706 Ga0466964_0401585 Ga0466964_0401585_12_452 146
99 3300044719 Ga0466971_0027718 Ga0466971_0027718_1007_1447 146
100 3300044719 Ga0466971_0247835 Ga0466971_0247835_256_696 146
101 3300044719 Ga0466971_0275902 Ga0466971_0275902_252_695 146
102 3300044765 Ga0466970_0037211 Ga0466970_0037211_817_1266 146
103 3300044765 Ga0466970_0076573 Ga0466970_0076573_480_920 146
104 3300044842 Ga0466957_0018000 Ga0466957_0018000_580_1023 146
105 3300044842 Ga0466957_0037376 Ga0466957_0037376_802_1242 146
106 3300044842 Ga0466957_0103237 Ga0466957_0103237_367_807 146
107 3300044842 Ga0466957_0123081 Ga0466957_0123081_619_1062 146
108 3300044842 Ga0466957_0132231 Ga0466957_0132231_969_1409 146
109 3300044842 Ga0466957_0412891 Ga0466957_0412891_468_908 146
110 3300044842 Ga0466957_0633505 Ga0466957_0633505_51_491 146
111 3300044842 Ga0466957_0921273 Ga0466957_0921273_24_464 146
112 3300044901 Ga0466960_0005472 Ga0466960_0005472_3438_3878 146
113 3300044901 Ga0466960_0054588 Ga0466960_0054588_1006_1446 146
114 3300044901 Ga0466960_0093825 Ga0466960_0093825_730_1170 146
115 3300044901 Ga0466960_0115408 Ga0466960_0115408_370_819 146
116 3300044901 Ga0466960_0187298 Ga0466960_0187298_438_878 146
117 3300044901 Ga0466960_0404631 Ga0466960_0404631_26_466 146
118 3300044901 Ga0466960_0642342 Ga0466960_0642342_22_480 146
119 3300045049 Ga0466959_0041322 Ga0466959_0041322_184_624 146
120 3300045049 Ga0466959_0096572 Ga0466959_0096572_938_1378 146
121 3300045049 Ga0466959_0274188 Ga0466959_0274188_420_863 146
122 3300045049 Ga0466959_0374885 Ga0466959_0374885_275_715 146
123 3300045049 Ga0466959_0388268 Ga0466959_0388268_370_810 146
124 3300045049 Ga0466959_0428629 Ga0466959_0428629_233_673 146
125 3300045836 Ga0466958_0009573 Ga0466958_0009573_4081_4521 146
126 3300045836 Ga0466958_0057070 Ga0466958_0057070_1814_2254 146
127 3300045836 Ga0466958_0087038 Ga0466958_0087038_1103_1543 146
128 3300045836 Ga0466958_0226511 Ga0466958_0226511_344_784 146
129 3300045836 Ga0466958_0272680 Ga0466958_0272680_219_662 146
130 3300045836 Ga0466958_0285166 Ga0466958_0285166_235_675 146
131 3300045836 Ga0466958_0357560 Ga0466958_0357560_294_734 146
132 3300045836 Ga0466958_0649940 Ga0466958_0649940_86_526 146
133 3300045976 Ga0466967_0002638 Ga0466967_0002638_4942_5382 146
134 3300045976 Ga0466967_0032115 Ga0466967_0032115_2030_2470 146
135 3300045976 Ga0466967_0096782 Ga0466967_0096782_1809_2249 146
136 3300045976 Ga0466967_0113994 Ga0466967_0113994_737_1177 146
137 3300045976 Ga0466967_0228910 Ga0466967_0228910_1045_1485 146
138 3300045976 Ga0466967_0377561 Ga0466967_0377561_377_817 146
139 3300045976 Ga0466967_0849986 Ga0466967_0849986_239_682 146
140 3300045976 Ga0466967_1230524 Ga0466967_1230524_22_462 146
141 3300045976 Ga0466967_1455450 Ga0466967_1455450_221_661 146
142 3300045976 Ga0466967_1647057 Ga0466967_1647057_72_512 146
143 3300045976 Ga0466967_1696454 Ga0466967_1696454_159_599 146
144 3300048905 Ga0496102_0649946 Ga0496102_0649946_225_665 146
145 3300048909 Ga0496106_1092983 Ga0496106_1092983_150_590 146
146 3300049533 Ga0501317_096085 Ga0501317_096085_29_469 146
147 3300049664 Ga0501224_085485 Ga0501224_085485_28_468 146
148 3300049822 Ga0501035_0030346 Ga0501035_0030346_3205_3645 146
149 3300049823 Ga0501044_0390176 Ga0501044_0390176_88_528 146
150 3300061719 Ga0466962_0067280 Ga0466962_0067280_282_722 146
151 3300061719 Ga0466962_0097820 Ga0466962_0097820_51_491 146
152 3300061719 Ga0466962_0602212 Ga0466962_0602212_72_512 146
153 3300061734 Ga0530510_0548297 Ga0530510_0548297_362_802 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

13

138

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8975 5 137
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8953 4 137
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.8859 2 142
3pu2-assembly1.cif.gz_A crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.8842 2 138
2lcg-assembly1.cif.gz_A solution nmr structure of protein rmet_5065 from ralstonia metallidurans, northeast structural genomics consortium target crr115 0.8842 5 137
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8827 5 137 3.30.530.20
2lghA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8678 5 141 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.859 1 137 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8463 5 137 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8441 2 141 3.30.530.20
ID Description Score Start End GO Terms
AF-R4LND7-F1-model_v4 Uncharacterized protein 1.003 1 139 GO:0046872
AF-A0A420XQV8-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9964 1 143
AF-A0A4Y9Q722-F1-model_v4 SRPBCC domain-containing protein 0.9947 1 142
AF-A0A1H0LTH2-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9799 5 141
AF-A0A4R7LZJ1-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9762 3 142

Feature Viewer

pLDDT pTM Quality
93.7 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map