F217345
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 153 | 30 | 306 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300031241|Ga0265325_10041259|Ga0265325_100412592 |
| Length | 265 |
| Sequence | LLATLDYHGSRLAGGVTVARSASGTSGLGAARRPDYSVGASMIELRDVKKAFNQGQHNEYWALSGITLNLEAKRVTALRGPSGSGKTTLLTLIGCLARPTSGRVSLHGRDISGLPERFLTEIRRQTFGFVFQQFNLIKGMSALENVMLPAFPTGRAHRELVHRADALLDRLRLAHRRDARAEWLSGGEQQRVAIARALINDPEVLIADEPTANLDTALAKEFMAILEGFGAEGRTVILTSHDPLVVESAAVHRVIDMRDGLLVEQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 2 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 3 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 4 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 5 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 6 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 7 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 8 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 9 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 10 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 11 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 12 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 13 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 14 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 15 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 16 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 17 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 18 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 19 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 20 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 21 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 22 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 23 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 24 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 25 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 26 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 27 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 28 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 29 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 30 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.69 |
| Metatranscriptomes | 0 |
| Isolates | 1.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 49.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265325_10041259 | 3300031241 | Bacteria | 2419 |
| 2 | Ga0265318_10089311 | 3300028577 | Bacteria | 1135 |
| 3 | Ga0265323_10012947 | 3300028653 | Bacteria | 3335 |
| 4 | Ga0307511_10000046 | 3300030521 | Bacteria | 100284 |
| 5 | Ga0265332_10000292 | 3300031238 | Bacteria | 39473 |
| 6 | Ga0316575_10028989 | 3300031665 | Bacteria | 2160 |
| 7 | Ga0316575_10063773 | 3300031665 | Bacteria | 1475 |
| 8 | Ga0265314_10004283 | 3300031711 | Bacteria | 13344 |
| 9 | Ga0316576_10003671 | 3300031727 | Bacteria | 9058 |
| 10 | Ga0316576_10007078 | 3300031727 | Bacteria | 7028 |
| 11 | Ga0316576_10021909 | 3300031727 | Bacteria | 4428 |
| 12 | Ga0316576_10039487 | 3300031727 | Bacteria | 3388 |
| 13 | Ga0316576_10489298 | 3300031727 | Bacteria | 906 |
| 14 | Ga0316578_10015499 | 3300031728 | Bacteria | 4100 |
| 15 | Ga0316578_10018901 | 3300031728 | Bacteria | 3785 |
| 16 | Ga0316577_10067089 | 3300031733 | Bacteria | 2003 |
| 17 | Ga0316577_10096953 | 3300031733 | Bacteria | 1652 |
| 18 | Ga0316583_10008064 | 3300032133 | Bacteria | 3796 |
| 19 | Ga0316585_10024185 | 3300032137 | Bacteria | 1878 |
| 20 | Ga0316574_0060823 | 3300035398 | Bacteria | 2371 |
| 21 | Ga0316574_0255529 | 3300035398 | Bacteria | 1119 |
| 22 | Ga0316582_0007051 | 3300036647 | Bacteria | 5963 |
| 23 | Ga0316582_0057682 | 3300036647 | Bacteria | 2481 |
| 24 | Ga0316584_0049474 | 3300036712 | Bacteria | 3142 |
| 25 | Ga0400484_18146 | 3300038725 | Bacteria | 29068 |
| 26 | Ga0400484_23580 | 3300038725 | Bacteria | 1023 |
| 27 | Ga0400484_30430 | 3300038725 | Bacteria | 11463 |
| 28 | Ga0400484_32036 | 3300038725 | Bacteria | 12709 |
| 29 | Ga0400484_41937 | 3300038725 | Bacteria | 2746 |
| 30 | Ga0400490_02839 | 3300038726 | Bacteria | 2691 |
| 31 | Ga0400490_05743 | 3300038726 | Bacteria | 21888 |
| 32 | Ga0400490_13987 | 3300038726 | Bacteria | 16241 |
| 33 | Ga0400490_19428 | 3300038726 | Bacteria | 1567 |
| 34 | Ga0400490_21334 | 3300038726 | Bacteria | 39061 |
| 35 | Ga0400490_29793 | 3300038726 | Bacteria | 15058 |
| 36 | Ga0400490_33185 | 3300038726 | Bacteria | 15502 |
| 37 | Ga0400490_40222 | 3300038726 | Bacteria | 38819 |
| 38 | Ga0400490_45494 | 3300038726 | Bacteria | 40576 |
| 39 | Ga0400490_45894 | 3300038726 | Bacteria | 9976 |
| 40 | Ga0400490_48244 | 3300038726 | Bacteria | 12604 |
| 41 | Ga0400491_10825 | 3300038727 | Bacteria | 3626 |
| 42 | Ga0400485_06758 | 3300038735 | Bacteria | 13442 |
| 43 | Ga0400485_11925 | 3300038735 | Bacteria | 6786 |
| 44 | Ga0400485_13477 | 3300038735 | Bacteria | 14082 |
| 45 | Ga0400485_14652 | 3300038735 | Bacteria | 151508 |
| 46 | Ga0400485_15083 | 3300038735 | Bacteria | 2117 |
| 47 | Ga0400485_16098 | 3300038735 | Bacteria | 1667 |
| 48 | Ga0400485_16210 | 3300038735 | Unclassified | 2865 |
| 49 | Ga0400485_21131 | 3300038735 | Bacteria | 1812 |
| 50 | Ga0400488_10433 | 3300038741 | Bacteria | 1771 |
| 51 | Ga0400488_19332 | 3300038741 | Bacteria | 6291 |
| 52 | Ga0400488_24746 | 3300038741 | Bacteria | 1094 |
| 53 | Ga0400488_30625 | 3300038741 | Bacteria | 6232 |
| 54 | Ga0400488_32910 | 3300038741 | Bacteria | 1627 |
| 55 | Ga0400488_34545 | 3300038741 | Unclassified | 2243 |
| 56 | Ga0400488_40544 | 3300038741 | Bacteria | 3410 |
| 57 | Ga0400488_41976 | 3300038741 | Bacteria | 1722 |
| 58 | Ga0400488_60009 | 3300038741 | Bacteria | 12506 |
| 59 | Ga0400486_07908 | 3300038742 | Bacteria | 8783 |
| 60 | Ga0400486_12572 | 3300038742 | Bacteria | 2109 |
| 61 | Ga0400486_13349 | 3300038742 | Bacteria | 1141 |
| 62 | Ga0400486_13805 | 3300038742 | Bacteria | 28292 |
| 63 | Ga0400486_17492 | 3300038742 | Bacteria | 2329 |
| 64 | Ga0400486_19703 | 3300038742 | Bacteria | 4873 |
| 65 | Ga0400486_19801 | 3300038742 | Bacteria | 9240 |
| 66 | Ga0400486_20748 | 3300038742 | Bacteria | 12952 |
| 67 | Ga0400486_23473 | 3300038742 | Bacteria | 4210 |
| 68 | Ga0400486_27663 | 3300038742 | Bacteria | 1944 |
| 69 | Ga0400483_014384 | 3300039062 | Bacteria | 3630 |
| 70 | Ga0400483_032216 | 3300039062 | Unclassified | 1929 |
| 71 | Ga0400483_056637 | 3300039062 | Bacteria | 12093 |
| 72 | Ga0400483_059390 | 3300039062 | Unclassified | 1220 |
| 73 | Ga0400483_087643 | 3300039062 | Bacteria | 14126 |
| 74 | Ga0400483_111765 | 3300039062 | Bacteria | 10965 |
| 75 | Ga0400483_112948 | 3300039062 | Bacteria | 4260 |
| 76 | Ga0400483_147369 | 3300039062 | Bacteria | 1573 |
| 77 | Ga0400483_150676 | 3300039062 | Bacteria | 2905 |
| 78 | Ga0400483_159084 | 3300039062 | Bacteria | 3230 |
| 79 | Ga0400483_177264 | 3300039062 | Bacteria | 1253 |
| 80 | Ga0400483_182735 | 3300039062 | Bacteria | 6733 |
| 81 | Ga0400483_206225 | 3300039062 | Bacteria | 2665 |
| 82 | Ga0400483_240248 | 3300039062 | Bacteria | 13138 |
| 83 | Ga0400483_262536 | 3300039062 | Bacteria | 1042 |
| 84 | Ga0400483_268430 | 3300039062 | Bacteria | 10039 |
| 85 | Ga0400483_269483 | 3300039062 | Bacteria | 5925 |
| 86 | Ga0400483_274913 | 3300039062 | Bacteria | 33006 |
| 87 | Ga0400489_10411 | 3300039093 | Bacteria | 1427 |
| 88 | Ga0400489_70367 | 3300039093 | Bacteria | 31608 |
| 89 | Ga0400487_17713 | 3300039110 | Bacteria | 2163 |
| 90 | Ga0400487_21009 | 3300039110 | Bacteria | 21751 |
| 91 | Ga0400487_28708 | 3300039110 | Unclassified | 4480 |
| 92 | Ga0400487_34271 | 3300039110 | Bacteria | 1419 |
| 93 | Ga0400487_35913 | 3300039110 | Bacteria | 6632 |
| 94 | Ga0400487_39521 | 3300039110 | Bacteria | 14077 |
| 95 | Ga0400487_39689 | 3300039110 | Bacteria | 1763 |
| 96 | Ga0400487_50760 | 3300039110 | Bacteria | 7486 |
| 97 | Ga0400487_55165 | 3300039110 | Bacteria | 23459 |
| 98 | Ga0400487_64252 | 3300039110 | Bacteria | 31497 |
| 99 | Ga0451577_0000040 | 3300042876 | Bacteria | 346755 |
| 100 | Ga0451577_0000254 | 3300042876 | Bacteria | 105712 |
| 101 | Ga0451577_0000981 | 3300042876 | Bacteria | 41544 |
| 102 | Ga0451577_0032650 | 3300042876 | Bacteria | 4690 |
| 103 | Ga0451577_0054547 | 3300042876 | Unclassified | 3568 |
| 104 | Ga0451577_0069146 | 3300042876 | Bacteria | 3149 |
| 105 | Ga0451577_0225772 | 3300042876 | Bacteria | 1693 |
| 106 | Ga0451577_0236733 | 3300042876 | Bacteria | 1651 |
| 107 | Ga0451577_0330991 | 3300042876 | Bacteria | 1381 |
| 108 | Ga0453683_0000197 | 3300044673 | Bacteria | 82391 |
| 109 | Ga0453683_0000233 | 3300044673 | Bacteria | 73679 |
| 110 | Ga0453683_0003013 | 3300044673 | Bacteria | 12615 |
| 111 | Ga0453683_0005698 | 3300044673 | Bacteria | 8648 |
| 112 | Ga0453683_0143822 | 3300044673 | Bacteria | 1505 |
| 113 | Ga0453683_0293268 | 3300044673 | Bacteria | 1040 |
| 114 | Ga0453683_0482805 | 3300044673 | Unclassified | 803 |
| 115 | Ga0453684_0000063 | 3300044712 | Bacteria | 486079 |
| 116 | Ga0453684_0000177 | 3300044712 | Bacteria | 282969 |
| 117 | Ga0453684_0000179 | 3300044712 | Bacteria | 280195 |
| 118 | Ga0453684_0000189 | 3300044712 | Bacteria | 269690 |
| 119 | Ga0453684_0000222 | 3300044712 | Bacteria | 249870 |
| 120 | Ga0453684_0000860 | 3300044712 | Bacteria | 102244 |
| 121 | Ga0453684_0001282 | 3300044712 | Bacteria | 75099 |
| 122 | Ga0453684_0002437 | 3300044712 | Bacteria | 45214 |
| 123 | Ga0453684_0005859 | 3300044712 | Bacteria | 23888 |
| 124 | Ga0453684_0006771 | 3300044712 | Bacteria | 21564 |
| 125 | Ga0453684_0015972 | 3300044712 | Bacteria | 11800 |
| 126 | Ga0453684_0016124 | 3300044712 | Bacteria | 11722 |
| 127 | Ga0453684_0019636 | 3300044712 | Bacteria | 10270 |
| 128 | Ga0453684_0026862 | 3300044712 | Bacteria | 8293 |
| 129 | Ga0453684_0119515 | 3300044712 | Bacteria | 3185 |
| 130 | Ga0453684_0159900 | 3300044712 | Bacteria | 2665 |
| 131 | Ga0453684_0168373 | 3300044712 | Bacteria | 2585 |
| 132 | Ga0453684_0185669 | 3300044712 | Bacteria | 2437 |
| 133 | Ga0453684_0204253 | 3300044712 | Bacteria | 2301 |
| 134 | Ga0453684_0247587 | 3300044712 | Bacteria | 2048 |
| 135 | Ga0453684_0318507 | 3300044712 | Bacteria | 1762 |
| 136 | Ga0453684_0612675 | 3300044712 | Bacteria | 1192 |
| 137 | Ga0453684_0698996 | 3300044712 | Bacteria | 1102 |
| 138 | Ga0451576_0000096 | 3300045051 | Bacteria | 221078 |
| 139 | Ga0451576_0000497 | 3300045051 | Bacteria | 86307 |
| 140 | Ga0451576_0005469 | 3300045051 | Bacteria | 15911 |
| 141 | Ga0451576_0005948 | 3300045051 | Bacteria | 15112 |
| 142 | Ga0451576_0006465 | 3300045051 | Bacteria | 14364 |
| 143 | Ga0451576_0007737 | 3300045051 | Bacteria | 12762 |
| 144 | Ga0451576_0019068 | 3300045051 | Bacteria | 7496 |
| 145 | Ga0451576_0033043 | 3300045051 | Bacteria | 5501 |
| 146 | Ga0451576_0116509 | 3300045051 | Bacteria | 2782 |
| 147 | Ga0451576_0201149 | 3300045051 | Bacteria | 2081 |
| 148 | Ga0451576_0243768 | 3300045051 | Bacteria | 1877 |
| 149 | Ga0451576_0277213 | 3300045051 | Bacteria | 1753 |
| 150 | Ga0451576_0309332 | 3300045051 | Bacteria | 1653 |
| 151 | Ga0451576_0602505 | 3300045051 | Bacteria | 1155 |
| 152 | 2526212732 | 2526164512 | Bacteria | 4025691 |
| 153 | 2548847717 | 2547132512 | Bacteria | 3416496 |
| 154 | Ga0265325_10041259 | |||
| 155 | Ga0265318_10089311 | |||
| 156 | Ga0265323_10012947 | |||
| 157 | Ga0307511_10000046 | |||
| 158 | Ga0265332_10000292 | |||
| 159 | Ga0316575_10028989 | |||
| 160 | Ga0316575_10063773 | |||
| 161 | Ga0265314_10004283 | |||
| 162 | Ga0316576_10003671 | |||
| 163 | Ga0316576_10007078 | |||
| 164 | Ga0316576_10021909 | |||
| 165 | Ga0316576_10039487 | |||
| 166 | Ga0316576_10489298 | |||
| 167 | Ga0316578_10015499 | |||
| 168 | Ga0316578_10018901 | |||
| 169 | Ga0316577_10067089 | |||
| 170 | Ga0316577_10096953 | |||
| 171 | Ga0316583_10008064 | |||
| 172 | Ga0316585_10024185 | |||
| 173 | Ga0316574_0060823 | |||
| 174 | Ga0316574_0255529 | |||
| 175 | Ga0316582_0007051 | |||
| 176 | Ga0316582_0057682 | |||
| 177 | Ga0316584_0049474 | |||
| 178 | Ga0400484_18146 | |||
| 179 | Ga0400484_23580 | |||
| 180 | Ga0400484_30430 | |||
| 181 | Ga0400484_32036 | |||
| 182 | Ga0400484_41937 | |||
| 183 | Ga0400490_02839 | |||
| 184 | Ga0400490_05743 | |||
| 185 | Ga0400490_13987 | |||
| 186 | Ga0400490_19428 | |||
| 187 | Ga0400490_21334 | |||
| 188 | Ga0400490_29793 | |||
| 189 | Ga0400490_33185 | |||
| 190 | Ga0400490_40222 | |||
| 191 | Ga0400490_45494 | |||
| 192 | Ga0400490_45894 | |||
| 193 | Ga0400490_48244 | |||
| 194 | Ga0400491_10825 | |||
| 195 | Ga0400485_06758 | |||
| 196 | Ga0400485_11925 | |||
| 197 | Ga0400485_13477 | |||
| 198 | Ga0400485_14652 | |||
| 199 | Ga0400485_15083 | |||
| 200 | Ga0400485_16098 | |||
| 201 | Ga0400485_16210 | |||
| 202 | Ga0400485_21131 | |||
| 203 | Ga0400488_10433 | |||
| 204 | Ga0400488_19332 | |||
| 205 | Ga0400488_24746 | |||
| 206 | Ga0400488_30625 | |||
| 207 | Ga0400488_32910 | |||
| 208 | Ga0400488_34545 | |||
| 209 | Ga0400488_40544 | |||
| 210 | Ga0400488_41976 | |||
| 211 | Ga0400488_60009 | |||
| 212 | Ga0400486_07908 | |||
| 213 | Ga0400486_12572 | |||
| 214 | Ga0400486_13349 | |||
| 215 | Ga0400486_13805 | |||
| 216 | Ga0400486_17492 | |||
| 217 | Ga0400486_19703 | |||
| 218 | Ga0400486_19801 | |||
| 219 | Ga0400486_20748 | |||
| 220 | Ga0400486_23473 | |||
| 221 | Ga0400486_27663 | |||
| 222 | Ga0400483_014384 | |||
| 223 | Ga0400483_032216 | |||
| 224 | Ga0400483_056637 | |||
| 225 | Ga0400483_059390 | |||
| 226 | Ga0400483_087643 | |||
| 227 | Ga0400483_111765 | |||
| 228 | Ga0400483_112948 | |||
| 229 | Ga0400483_147369 | |||
| 230 | Ga0400483_150676 | |||
| 231 | Ga0400483_159084 | |||
| 232 | Ga0400483_177264 | |||
| 233 | Ga0400483_182735 | |||
| 234 | Ga0400483_206225 | |||
| 235 | Ga0400483_240248 | |||
| 236 | Ga0400483_262536 | |||
| 237 | Ga0400483_268430 | |||
| 238 | Ga0400483_269483 | |||
| 239 | Ga0400483_274913 | |||
| 240 | Ga0400489_10411 | |||
| 241 | Ga0400489_70367 | |||
| 242 | Ga0400487_17713 | |||
| 243 | Ga0400487_21009 | |||
| 244 | Ga0400487_28708 | |||
| 245 | Ga0400487_34271 | |||
| 246 | Ga0400487_35913 | |||
| 247 | Ga0400487_39521 | |||
| 248 | Ga0400487_39689 | |||
| 249 | Ga0400487_50760 | |||
| 250 | Ga0400487_55165 | |||
| 251 | Ga0400487_64252 | |||
| 252 | Ga0451577_0000040 | |||
| 253 | Ga0451577_0000254 | |||
| 254 | Ga0451577_0000981 | |||
| 255 | Ga0451577_0032650 | |||
| 256 | Ga0451577_0054547 | |||
| 257 | Ga0451577_0069146 | |||
| 258 | Ga0451577_0225772 | |||
| 259 | Ga0451577_0236733 | |||
| 260 | Ga0451577_0330991 | |||
| 261 | Ga0453683_0000197 | |||
| 262 | Ga0453683_0000233 | |||
| 263 | Ga0453683_0003013 | |||
| 264 | Ga0453683_0005698 | |||
| 265 | Ga0453683_0143822 | |||
| 266 | Ga0453683_0293268 | |||
| 267 | Ga0453683_0482805 | |||
| 268 | Ga0453684_0000063 | |||
| 269 | Ga0453684_0000177 | |||
| 270 | Ga0453684_0000179 | |||
| 271 | Ga0453684_0000189 | |||
| 272 | Ga0453684_0000222 | |||
| 273 | Ga0453684_0000860 | |||
| 274 | Ga0453684_0001282 | |||
| 275 | Ga0453684_0002437 | |||
| 276 | Ga0453684_0005859 | |||
| 277 | Ga0453684_0006771 | |||
| 278 | Ga0453684_0015972 | |||
| 279 | Ga0453684_0016124 | |||
| 280 | Ga0453684_0019636 | |||
| 281 | Ga0453684_0026862 | |||
| 282 | Ga0453684_0119515 | |||
| 283 | Ga0453684_0159900 | |||
| 284 | Ga0453684_0168373 | |||
| 285 | Ga0453684_0185669 | |||
| 286 | Ga0453684_0204253 | |||
| 287 | Ga0453684_0247587 | |||
| 288 | Ga0453684_0318507 | |||
| 289 | Ga0453684_0612675 | |||
| 290 | Ga0453684_0698996 | |||
| 291 | Ga0451576_0000096 | |||
| 292 | Ga0451576_0000497 | |||
| 293 | Ga0451576_0005469 | |||
| 294 | Ga0451576_0005948 | |||
| 295 | Ga0451576_0006465 | |||
| 296 | Ga0451576_0007737 | |||
| 297 | Ga0451576_0019068 | |||
| 298 | Ga0451576_0033043 | |||
| 299 | Ga0451576_0116509 | |||
| 300 | Ga0451576_0201149 | |||
| 301 | Ga0451576_0243768 | |||
| 302 | Ga0451576_0277213 | |||
| 303 | Ga0451576_0309332 | |||
| 304 | Ga0451576_0602505 | |||
| 305 | 2526212732 | |||
| 306 | 2548847717 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9542 | 1 | 242 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9539 | 1 | 239 |
| 5ws4-assembly1.cif.gz_B | crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii | 0.9528 | 2 | 242 |
| 5lj9-assembly3.cif.gz_C | structure of the e. coli macb abc domain (c2221) | 0.9527 | 2 | 242 |
| 5nik-assembly1.cif.gz_J | structure of the macab-tolc abc-type tripartite multidrug efflux pump | 0.945 | 2 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUZ1_1_243_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9541 | 1 | 239 | 3.40.50.300 |
| 5xu1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9539 | 1 | 239 | 3.40.50.300 |
| af_P75957_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9529 | 1 | 236 | 3.40.50.300 |
| 2pclA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9422 | 1 | 242 | 3.40.50.300 |
| af_O05779_1_226_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9416 | 2 | 240 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5M6IEF2-F1-model_v4 | ABC transporter ATP-binding protein | 0.9672 | 1 | 236 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A838DTV6-F1-model_v4 | ABC transporter ATP-binding protein | 0.9647 | 1 | 242 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A372E171-F1-model_v4 | ABC transporter ATP-binding protein | 0.9626 | 1 | 239 |
GO:0005524
GO:0016887 |
| AF-A0A1A9FAL8-F1-model_v4 | deleted | 0.9615 | 1 | 240 |
|
| AF-A0A1E4BE00-F1-model_v4 | Macrolide ABC transporter ATP-binding protein | 0.9581 | 1 | 240 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |