F217001

General Info

Members Datasets Scaffolds Average Seq Length
153 116 139 216

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10249669|Ga0157372_102496692
Length 240
Sequence VTIATGLDMKRTLPGTLGTAHDEGGAMRVVIAGGHGKVALRLERRLSEAGDQAVGMVRNPDHVPDVERTGAQAVVLDLEHTTVDALAEQLTGADAVVFAAGGGPGSGAARKETVDRGAAVLLADAAEHGGVRRYVMVSSMGTDRADPDSDDIFQVYLRAKRAADDELRGRDLDWTIMHPGRLTDDTGTGRIQVGRLQPGAVTREDVAAALVAVLHDERTIGKDFDLLNGDQPIEDALAAL

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
3 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
4 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
5 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
6 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
7 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
8 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
9 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
10 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
11 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
47 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
48 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
49 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
50 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
51 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
57 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
66 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
67 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
68 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
69 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
70 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
110 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
111 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
112 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
113 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
114 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
115 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
116 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.2
Metatranscriptomes 0.65
Isolates 9.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.96
Nodule 0
Rhizoplane 16.34
Rhizosphere 67.32
Stem 0
Stem Tuber 0
Unclassified 14.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10454499 3300005327 Bacteria 1104
2 Ga0070680_100116772 3300005336 Bacteria 2225
3 Ga0070682_100020981 3300005337 Bacteria 3850
4 Ga0070660_100674530 3300005339 Bacteria 866
5 Ga0070687_100325117 3300005343 Bacteria 984
6 Ga0070687_100386601 3300005343 Bacteria 913
7 Ga0070663_100204152 3300005455 Bacteria 1544
8 Ga0070678_100194154 3300005456 Bacteria 1671
9 Ga0070678_100299026 3300005456 Bacteria 1367
10 Ga0070678_100828635 3300005456 Bacteria 842
11 Ga0070706_100181045 3300005467 Bacteria 1968
12 Ga0070679_100407149 3300005530 Bacteria 1306
13 Ga0068858_100839466 3300005842 Bacteria 897
14 Ga0075365_10388588 3300006038 Bacteria 984
15 Ga0068865_100277483 3300006881 Bacteria 1333
16 Ga0068865_100440073 3300006881 Bacteria 1076
17 Ga0111539_10244782 3300009094 Bacteria 2088
18 Ga0105245_10032961 3300009098 Bacteria 4587
19 Ga0105249_11339098 3300009553 Bacteria 788
20 Ga0157369_10213438 3300013105 Bacteria 2022
21 Ga0163162_10246234 3300013306 Bacteria 1919
22 Ga0157372_10249669 3300013307 Bacteria 2059
23 Ga0157375_10383190 3300013308 Bacteria 1573
24 Ga0157375_10514634 3300013308 Bacteria 1360
25 Ga0163163_10245582 3300014325 Bacteria 1840
26 Ga0157376_10392956 3300014969 Bacteria 1339
27 Ga0163161_10539658 3300017792 Bacteria 955
28 Ga0163161_10661393 3300017792 Bacteria 866
29 Ga0206353_11411345 3300020082 Bacteria 2446
30 Ga0213873_10115264 3300021358 Unclassified 784
31 Ga0213876_10002441 3300021384 Bacteria 10925
32 Ga0213875_10092360 3300021388 Bacteria 1412
33 Ga0207660_10162769 3300025917 Bacteria 1723
34 Ga0207652_10363674 3300025921 Bacteria 1306
35 Ga0207687_10582828 3300025927 Bacteria 941
36 Ga0207690_10098499 3300025932 Bacteria 2083
37 Ga0207669_10230636 3300025937 Bacteria 1366
38 Ga0207691_10660839 3300025940 Bacteria 883
39 Ga0207678_10219209 3300026067 Bacteria 1628
40 Ga0207678_10532331 3300026067 Bacteria 1026
41 Ga0207683_10106373 3300026121 Bacteria 2509
42 Ga0307508_10038333 3300031616 Bacteria 4308
43 Ga0307508_10276941 3300031616 Bacteria 1271
44 Ga0316575_10026040 3300031665 Bacteria 2271
45 Ga0316575_10121609 3300031665 Bacteria 1068
46 Ga0316579_10001600 3300031691 Bacteria 8281
47 Ga0316576_10199489 3300031727 Bacteria 1507
48 Ga0316578_10017853 3300031728 Bacteria 3872
49 Ga0316578_10389313 3300031728 Bacteria 827
50 Ga0307406_10087421 3300031901 Bacteria 2089
51 Ga0307406_10158800 3300031901 Bacteria 1622
52 Ga0307409_100024243 3300031995 Bacteria 4227
53 Ga0307409_100039270 3300031995 Bacteria 3510
54 Ga0307409_100245556 3300031995 Bacteria 1633
55 Ga0307416_100033808 3300032002 Bacteria 3882
56 Ga0307416_100270189 3300032002 Bacteria 1669
57 Ga0307416_100733041 3300032002 Bacteria 1080
58 Ga0307416_101202088 3300032002 Bacteria 864
59 Ga0307411_10325510 3300032005 Bacteria 1243
60 Ga0307415_100749471 3300032126 Bacteria 886
61 Ga0316580_10016365 3300032139 Bacteria 2275
62 Ga0316574_0085130 3300035398 Bacteria 2011
63 Ga0316574_0127644 3300035398 Bacteria 1635
64 Ga0395899_0053564 3300037312 Bacteria 2987
65 Ga0395899_0056374 3300037312 Bacteria 2904
66 Ga0395900_0216326 3300037418 Bacteria 1933
67 Ga0395900_0517337 3300037418 Bacteria 1142
68 Ga0395898_0128963 3300037466 Bacteria 2423
69 Ga0395905_0074956 3300037471 Bacteria 3171
70 Ga0436364_1248894 3300037853 Bacteria 1903
71 Ga0395901_0122746 3300038443 Bacteria 2730
72 Ga0395901_0133360 3300038443 Bacteria 2610
73 Ga0436365_0248508 3300039437 Bacteria 47975
74 Ga0436365_1653066 3300039437 Bacteria 1253
75 Ga0436362_0447721 3300039453 Bacteria 3145
76 Ga0451791_0964770 3300041451 Bacteria 7038
77 Ga0451797_0242169 3300041453 Bacteria 7735
78 Ga0451800_0941027 3300041459 Bacteria 3246
79 Ga0451839_0351870 3300041496 Bacteria 1406
80 Ga0451843_0711103 3300041509 Bacteria 2933
81 Ga0451853_0992584 3300041512 Bacteria 3385
82 Ga0466965_0016271 3300044683 Bacteria 3538
83 Ga0466965_0023669 3300044683 Bacteria 2966
84 Ga0466963_0016160 3300044694 Bacteria 4638
85 Ga0466964_0081123 3300044706 Bacteria 1393
86 Ga0466971_0165653 3300044719 Bacteria 1036
87 Ga0466960_0011749 3300044901 Bacteria 3676
88 Ga0466960_0074832 3300044901 Bacteria 1693
89 Ga0466958_0045527 3300045836 Bacteria 2647
90 Ga0466967_0000944 3300045976 Bacteria 15684
91 Ga0466967_0070723 3300045976 Bacteria 3122
92 Ga0466967_0178418 3300045976 Bacteria 2002
93 Ga0466967_1007982 3300045976 Bacteria 829
94 Ga0466967_1134857 3300045976 Bacteria 779
95 Ga0495603_0124690 3300046455 Bacteria 1501
96 Ga0495629_0089246 3300046459 Bacteria 2151
97 Ga0495650_0142002 3300046471 Bacteria 868
98 Ga0495582_0155141 3300046473 Bacteria 1301
99 Ga0495607_0083925 3300046501 Bacteria 1744
100 Ga0495628_0014253 3300046516 Bacteria 6670
101 Ga0495665_0181221 3300046531 Bacteria 1095
102 Ga0495667_0381111 3300046559 Bacteria 889
103 Ga0495604_0099666 3300047317 Bacteria 2137
104 Ga0495676_0450822 3300047321 Bacteria 849
105 Ga0495683_0001143 3300047323 Bacteria 18273
106 Ga0496101_0140249 3300048904 Bacteria 1842
107 Ga0496102_0013939 3300048905 Bacteria 6977
108 Ga0496102_0187360 3300048905 Bacteria 1950
109 Ga0496102_0522889 3300048905 Bacteria 1109
110 Ga0496103_0258135 3300048906 Bacteria 1121
111 Ga0496104_0000705 3300048907 Bacteria 28693
112 Ga0496104_0254527 3300048907 Bacteria 1669
113 Ga0496105_0001141 3300048908 Bacteria 18529
114 Ga0496108_0001810 3300048911 Bacteria 17053
115 Ga0496108_0317448 3300048911 Bacteria 1358
116 Ga0496109_0654098 3300048912 Bacteria 988
117 Ga0496109_0673872 3300048912 Bacteria 971
118 Ga0496109_0817712 3300048912 Bacteria 870
119 Ga0496110_0008827 3300048913 Bacteria 8119
120 Ga0496111_0000860 3300048914 Bacteria 16465
121 Ga0496111_0003008 3300048914 Bacteria 10322
122 Ga0496113_0001920 3300048916 Bacteria 11881
123 Ga0496114_0024621 3300048917 Bacteria 4913
124 Ga0496114_0087610 3300048917 Bacteria 2640
125 Ga0496114_0104153 3300048917 Bacteria 2426
126 Ga0496114_0588261 3300048917 Bacteria 982
127 Ga0496115_0032678 3300048918 Bacteria 4106
128 Ga0496117_0000048 3300048920 Bacteria 295908
129 Ga0496122_0030435 3300048925 Bacteria 4522
130 Ga0496124_0158219 3300048927 Bacteria 1769
131 Ga0501067_0010677 3300049583 Bacteria 5081
132 Ga0501068_0062419 3300049584 Bacteria 2266
133 Ga0501069_0098577 3300049585 Bacteria 1658
134 Ga0501079_0168018 3300049741 Bacteria 1711
135 Ga0495601_0000908 3300053077 Bacteria 16118
136 Ga0495612_0008403 3300053078 Bacteria 4187
137 Ga0495595_0052898 3300053084 Bacteria 1886
138 Ga0500616_0000040 3300053153 Bacteria 367604
139 Ga0500620_088737 3300053155 Bacteria 1076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100116772 Ga0070680_1001167722 196
2 3300025917 Ga0207660_10162769 Ga0207660_101627692 196
3 3300006038 Ga0075365_10388588 Ga0075365_103885882 197
4 3300039437 Ga0436365_1653066 Ga0436365_1653066_277_921 197
5 3300005530 Ga0070679_100407149 Ga0070679_1004071492 198
6 3300025921 Ga0207652_10363674 Ga0207652_103636741 198
7 3300031901 Ga0307406_10087421 Ga0307406_100874212 198
8 3300032126 Ga0307415_100749471 Ga0307415_1007494712 198
9 3300005456 Ga0070678_100194154 Ga0070678_1001941542 199
10 3300025940 Ga0207691_10660839 Ga0207691_106608391 199
11 3300026067 Ga0207678_10532331 Ga0207678_105323311 199
12 3300048912 Ga0496109_0817712 Ga0496109_0817712_96_740 199
13 3300006881 Ga0068865_100277483 Ga0068865_1002774832 200
14 3300009553 Ga0105249_11339098 Ga0105249_113390981 200
15 3300017792 Ga0163161_10661393 Ga0163161_106613931 200
16 3300021388 Ga0213875_10092360 Ga0213875_100923602 200
17 3300037853 Ga0436364_1248894 Ga0436364_1248894_528_1172 200
18 3300025932 Ga0207690_10098499 Ga0207690_100984992 201
19 3300044901 Ga0466960_0011749 Ga0466960_0011749_2582_3226 202
20 3300046471 Ga0495650_0142002 Ga0495650_0142002_106_768 202
21 3300032002 Ga0307416_100270189 Ga0307416_1002701892 204
22 3300045976 Ga0466967_1007982 Ga0466967_1007982_175_819 204
23 3300044683 Ga0466965_0016271 Ga0466965_0016271_2487_3164 205
24 3300044901 Ga0466960_0074832 Ga0466960_0074832_783_1460 205
25 3300005343 Ga0070687_100325117 Ga0070687_1003251171 206
26 3300017792 Ga0163161_10539658 Ga0163161_105396581 206
27 3300025927 Ga0207687_10582828 Ga0207687_105828281 206
28 3300045976 Ga0466967_1134857 Ga0466967_1134857_132_752 206
29 3300049585 Ga0501069_0098577 Ga0501069_0098577_875_1519 206
30 3300049741 Ga0501079_0168018 Ga0501079_0168018_410_1060 206
31 3300053077 Ga0495601_0000908 Ga0495601_0000908_4860_5489 209
32 3300053078 Ga0495612_0008403 Ga0495612_0008403_754_1383 209
33 3300046501 Ga0495607_0083925 Ga0495607_0083925_790_1449 210
34 3300047323 Ga0495683_0001143 Ga0495683_0001143_6192_6851 210
35 3300005467 Ga0070706_100181045 Ga0070706_1001810452 211
36 3300031616 Ga0307508_10038333 Ga0307508_100383332 211
37 3300031616 Ga0307508_10276941 Ga0307508_102769411 211
38 3300046473 Ga0495582_0155141 Ga0495582_0155141_647_1285 211
39 3300046516 Ga0495628_0014253 Ga0495628_0014253_2663_3298 211
40 3300046531 Ga0495665_0181221 Ga0495665_0181221_381_1049 211
41 iso_pu_bacteria 2844852863 2844853009 211
42 iso_pu_bacteria 8056037122 8056038289 211
43 iso_pu_bacteria 8057345674 8057345988 211
44 3300005339 Ga0070660_100674530 Ga0070660_1006745301 212
45 3300005842 Ga0068858_100839466 Ga0068858_1008394661 212
46 3300006881 Ga0068865_100440073 Ga0068865_1004400732 212
47 3300013306 Ga0163162_10246234 Ga0163162_102462342 212
48 3300025937 Ga0207669_10230636 Ga0207669_102306362 212
49 3300026121 Ga0207683_10106373 Ga0207683_101063733 212
50 3300046455 Ga0495603_0124690 Ga0495603_0124690_675_1343 212
51 3300046459 Ga0495629_0089246 Ga0495629_0089246_1194_1862 212
52 3300047321 Ga0495676_0450822 Ga0495676_0450822_69_737 212
53 3300048905 Ga0496102_0187360 Ga0496102_0187360_989_1657 212
54 3300048911 Ga0496108_0317448 Ga0496108_0317448_671_1339 212
55 3300048917 Ga0496114_0104153 Ga0496114_0104153_1233_1901 212
56 3300009094 Ga0111539_10244782 Ga0111539_102447823 214
57 3300021358 Ga0213873_10115264 Ga0213873_101152641 214
58 3300021384 Ga0213876_10002441 Ga0213876_100024414 214
59 3300031901 Ga0307406_10158800 Ga0307406_101588002 214
60 3300031995 Ga0307409_100039270 Ga0307409_1000392702 214
61 3300031995 Ga0307409_100245556 Ga0307409_1002455562 214
62 3300032005 Ga0307411_10325510 Ga0307411_103255102 214
63 3300038443 Ga0395901_0122746 Ga0395901_0122746_1390_2034 214
64 3300039437 Ga0436365_0248508 Ga0436365_0248508_30970_31614 214
65 3300039453 Ga0436362_0447721 Ga0436362_0447721_18_662 214
66 3300044683 Ga0466965_0023669 Ga0466965_0023669_1915_2559 214
67 3300044706 Ga0466964_0081123 Ga0466964_0081123_648_1292 214
68 3300044719 Ga0466971_0165653 Ga0466971_0165653_120_764 214
69 3300045976 Ga0466967_0000944 Ga0466967_0000944_3508_4155 214
70 3300048907 Ga0496104_0254527 Ga0496104_0254527_40_684 214
71 3300048912 Ga0496109_0673872 Ga0496109_0673872_300_944 214
72 3300049583 Ga0501067_0010677 Ga0501067_0010677_1055_1699 214
73 3300049584 Ga0501068_0062419 Ga0501068_0062419_1245_1889 214
74 3300053155 Ga0500620_088737 Ga0500620_088737_365_1009 214
75 iso_pu_bacteria 2643221567 2643849996 214
76 iso_pu_bacteria 2643221624 2644135998 214
77 iso_pu_bacteria 2873314349 2873317632 214
78 iso_pu_bacteria 8055066027 8055071745 214
79 3300048920 Ga0496117_0000048 Ga0496117_0000048_141874_142527 215
80 3300048925 Ga0496122_0030435 Ga0496122_0030435_1170_1823 215
81 3300053153 Ga0500616_0000040 Ga0500616_0000040_212286_212939 215
82 iso_pu_bacteria 2558860112 2558914050 215
83 iso_pu_bacteria 2643221690 2644505554 215
84 iso_pu_bacteria 2643221694 2644524638 215
85 iso_pu_bacteria 2643221722 2644668707 215
86 iso_pu_bacteria 2884994152 2884997124 215
87 3300037312 Ga0395899_0053564 Ga0395899_0053564_205_855 216
88 3300037418 Ga0395900_0216326 Ga0395900_0216326_1186_1836 216
89 3300037471 Ga0395905_0074956 Ga0395905_0074956_2060_2710 216
90 3300020082 Ga0206353_11411345 Ga0206353_114113453 217
91 3300031665 Ga0316575_10026040 Ga0316575_100260402 217
92 3300031665 Ga0316575_10121609 Ga0316575_101216092 217
93 3300031691 Ga0316579_10001600 Ga0316579_100016004 217
94 3300031727 Ga0316576_10199489 Ga0316576_101994892 217
95 3300031728 Ga0316578_10017853 Ga0316578_100178534 217
96 3300031728 Ga0316578_10389313 Ga0316578_103893131 217
97 3300032139 Ga0316580_10016365 Ga0316580_100163653 217
98 3300035398 Ga0316574_0085130 Ga0316574_0085130_620_1276 217
99 3300035398 Ga0316574_0127644 Ga0316574_0127644_845_1501 217
100 3300037418 Ga0395900_0517337 Ga0395900_0517337_265_921 217
101 3300037466 Ga0395898_0128963 Ga0395898_0128963_1078_1734 217
102 3300038443 Ga0395901_0133360 Ga0395901_0133360_841_1497 217
103 3300005456 Ga0070678_100299026 Ga0070678_1002990262 218
104 3300009098 Ga0105245_10032961 Ga0105245_100329613 218
105 3300013105 Ga0157369_10213438 Ga0157369_102134382 218
106 3300013308 Ga0157375_10383190 Ga0157375_103831903 218
107 3300031995 Ga0307409_100024243 Ga0307409_1000242432 218
108 3300032002 Ga0307416_100033808 Ga0307416_1000338085 218
109 3300048904 Ga0496101_0140249 Ga0496101_0140249_320_1054 218
110 3300048912 Ga0496109_0654098 Ga0496109_0654098_120_776 218
111 3300005343 Ga0070687_100386601 Ga0070687_1003866011 219
112 3300013308 Ga0157375_10514634 Ga0157375_105146342 219
113 3300032002 Ga0307416_100733041 Ga0307416_1007330411 219
114 3300032002 Ga0307416_101202088 Ga0307416_1012020881 219
115 3300044694 Ga0466963_0016160 Ga0466963_0016160_1579_2241 219
116 3300045836 Ga0466958_0045527 Ga0466958_0045527_514_1176 219
117 3300045976 Ga0466967_0070723 Ga0466967_0070723_1838_2500 219
118 3300045976 Ga0466967_0178418 Ga0466967_0178418_1087_1779 219
119 3300047317 Ga0495604_0099666 Ga0495604_0099666_754_1422 219
120 3300048905 Ga0496102_0013939 Ga0496102_0013939_4059_4727 219
121 3300048905 Ga0496102_0522889 Ga0496102_0522889_278_940 219
122 3300048906 Ga0496103_0258135 Ga0496103_0258135_327_995 219
123 3300048907 Ga0496104_0000705 Ga0496104_0000705_7482_8150 219
124 3300048908 Ga0496105_0001141 Ga0496105_0001141_12714_13382 219
125 3300048911 Ga0496108_0001810 Ga0496108_0001810_6326_6994 219
126 3300048913 Ga0496110_0008827 Ga0496110_0008827_3087_3755 219
127 3300048914 Ga0496111_0000860 Ga0496111_0000860_13958_14623 219
128 3300048914 Ga0496111_0003008 Ga0496111_0003008_3220_3888 219
129 3300048916 Ga0496113_0001920 Ga0496113_0001920_6401_7069 219
130 3300048917 Ga0496114_0024621 Ga0496114_0024621_92_760 219
131 3300048917 Ga0496114_0087610 Ga0496114_0087610_1229_1891 219
132 3300048917 Ga0496114_0588261 Ga0496114_0588261_63_722 219
133 3300048918 Ga0496115_0032678 Ga0496115_0032678_813_1481 219
134 3300048927 Ga0496124_0158219 Ga0496124_0158219_458_1123 219
135 3300013307 Ga0157372_10249669 Ga0157372_102496692 220
136 3300037312 Ga0395899_0056374 Ga0395899_0056374_511_1203 221
137 iso_pu_bacteria 2643221601 2644015528 223
138 iso_pu_bacteria 2643221631 2644178050 223
139 3300005455 Ga0070663_100204152 Ga0070663_1002041522 224
140 3300026067 Ga0207678_10219209 Ga0207678_102192092 224
141 3300005327 Ga0070658_10454499 Ga0070658_104544992 225
142 3300005337 Ga0070682_100020981 Ga0070682_1000209813 225
143 3300005456 Ga0070678_100828635 Ga0070678_1008286351 225
144 3300014325 Ga0163163_10245582 Ga0163163_102455823 225
145 3300014969 Ga0157376_10392956 Ga0157376_103929561 225
146 3300041451 Ga0451791_0964770 Ga0451791_0964770_5613_6290 225
147 3300041453 Ga0451797_0242169 Ga0451797_0242169_2800_3477 225
148 3300041459 Ga0451800_0941027 Ga0451800_0941027_129_806 225
149 3300041496 Ga0451839_0351870 Ga0451839_0351870_150_827 225
150 3300041509 Ga0451843_0711103 Ga0451843_0711103_1467_2144 225
151 3300041512 Ga0451853_0992584 Ga0451853_0992584_2380_3057 225
152 3300046559 Ga0495667_0381111 Ga0495667_0381111_69_788 225
153 3300053084 Ga0495595_0052898 Ga0495595_0052898_810_1529 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13460

NAD_binding_10

NAD(P)H-binding

33

217

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

29

181

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e8x-assembly1.cif.gz_A-2 putative nad-dependent epimerase/dehydratase from bacillus halodurans. 0.9176 7 219
3e8x-assembly1.cif.gz_A-2 putative nad-dependent epimerase/dehydratase from bacillus halodurans. 0.897 7 219
3dqp-assembly1.cif.gz_A-2 crystal structure of the oxidoreductase ylbe from lactococcus lactis, northeast structural genomics consortium target kr121. 0.8909 7 225
6rfq-assembly1.cif.gz_E cryo-em structure of a respiratory complex i assembly intermediate with ndufaf2 0.8749 7 207
6opl-assembly1.cif.gz_A human biliverdin ix beta reductase q14r mutant: nadp complex 0.871 6 211
ID Description Score Start End Superfamily
af_Q04304_5_227_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9412 9 221 3.40.50.720
af_Q2FWB1_2_220_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9284 9 224 3.40.50.720
3e8xA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9243 8 219 3.40.50.720
af_Q9Y7K0_5_242_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9211 11 224 3.40.50.720
af_Q2FWB1_2_220_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.912 9 224 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0P9SM37-F1-model_v4 Oxidoreductase ylbE 0.9957 148 223
AF-A0A529QUU5-F1-model_v4 SDR family oxidoreductase 0.9922 137 224 GO:0006520
AF-A0A1T4STH8-F1-model_v4 NAD(P)H-binding 0.9919 7 221
AF-A0A511FAW6-F1-model_v4 NAD-dependent dehydratase 0.9919 7 221
AF-A0A5P2V0J2-F1-model_v4 NAD(P)-binding domain-containing protein 0.9918 147 221

Feature Viewer

pLDDT pTM Quality
94.23 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map