F216938

General Info

Members Datasets Scaffolds Average Seq Length
153 128 150 169

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10408961|Ga0105239_104089612
Length 194
Sequence MLLFFPLTLLVSPAYAFISKMDSSQLKSLQSPLKQKYKDDPSSAVVTLRASGRLDAPGVSCRVDTGRALVEAGLHPATGGTGLQACSGDMLLEALAACAGVTLRAVATALEIPVRGGTVEVEGDLDFRGTLGVSKEAPVGFREIRMRLNLDTDATPDQLATLHKLTERYCVVLQTLKTSPAVASKMDTLAADER

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
3 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
72 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
73 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
74 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
84 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
85 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
86 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 0
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 0
Rhizoplane 6.54
Rhizosphere 84.97
Stem 0
Stem Tuber 0
Unclassified 3.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1003155 3300003781 Bacteria 8945
2 Ga0055530_10039329 3300003791 Bacteria 1169
3 Ga0070680_100400613 3300005336 Bacteria 1170
4 Ga0070660_100403277 3300005339 Bacteria 1131
5 Ga0070689_100155365 3300005340 Bacteria 1847
6 Ga0070675_100488863 3300005354 Bacteria 1108
7 Ga0070713_100699572 3300005436 Bacteria 967
8 Ga0070663_100247099 3300005455 Bacteria 1411
9 Ga0070706_100233154 3300005467 Bacteria 1718
10 Ga0070707_100045845 3300005468 Bacteria 4183
11 Ga0070698_100466340 3300005471 Bacteria 1199
12 Ga0070684_100337072 3300005535 Bacteria 1386
13 Ga0070697_100676972 3300005536 Bacteria 909
14 Ga0070696_100214938 3300005546 Bacteria 1441
15 Ga0070693_100129647 3300005547 Bacteria 1575
16 Ga0070704_100674662 3300005549 Bacteria 914
17 Ga0070664_100210915 3300005564 Bacteria 1736
18 Ga0070702_100381929 3300005615 Bacteria 1002
19 Ga0068859_100810964 3300005617 Bacteria 1023
20 Ga0068864_100453137 3300005618 Bacteria 1227
21 Ga0068858_101410946 3300005842 Bacteria 686
22 Ga0070716_100120195 3300006173 Bacteria 1643
23 Ga0070712_100327268 3300006175 Bacteria 1248
24 Ga0075366_10082847 3300006195 Bacteria 1917
25 Ga0097621_100368255 3300006237 Unclassified 1281
26 Ga0075430_101347421 3300006846 Bacteria 587
27 Ga0075431_100065846 3300006847 Bacteria 3741
28 Ga0075431_100909928 3300006847 Bacteria 849
29 Ga0075431_101258853 3300006847 Bacteria 701
30 Ga0075433_10913781 3300006852 Bacteria 765
31 Ga0075436_100137971 3300006914 Bacteria 1713
32 Ga0097620_100811149 3300006931 Bacteria 1023
33 Ga0111539_10114364 3300009094 Bacteria 3165
34 Ga0114129_11105932 3300009147 Bacteria 992
35 Ga0105242_10334577 3300009176 Bacteria 1393
36 Ga0105248_11048358 3300009177 Bacteria 921
37 Ga0105238_10819032 3300009551 Unclassified 947
38 Ga0105239_10408961 3300010375 Bacteria 1536
39 Ga0105246_10412725 3300011119 Bacteria 1124
40 Ga0157379_10223271 3300014968 Bacteria 1707
41 Ga0213876_10348388 3300021384 Bacteria 788
42 Ga0209565_1002150 3300025263 Bacteria 7432
43 Ga0209676_1000019 3300025292 Bacteria 620012
44 Ga0209050_1001530 3300025298 Bacteria 24352
45 Ga0209050_1012056 3300025298 Bacteria 4014
46 Ga0207697_10075306 3300025315 Bacteria 1418
47 Ga0207649_10510246 3300025920 Bacteria 915
48 Ga0207646_10155070 3300025922 Bacteria 2065
49 Ga0207646_10194360 3300025922 Unclassified 1832
50 Ga0207659_10216386 3300025926 Bacteria 1538
51 Ga0207700_10008081 3300025928 Bacteria 6491
52 Ga0207700_10414904 3300025928 Bacteria 1182
53 Ga0207711_11313550 3300025941 Bacteria 665
54 Ga0207679_10077219 3300025945 Bacteria 2533
55 Ga0207703_11710589 3300026035 Bacteria 605
56 Ga0207678_10239654 3300026067 Bacteria 1553
57 Ga0207708_10381981 3300026075 Bacteria 1161
58 Ga0207708_10726070 3300026075 Bacteria 851
59 Ga0207676_10437487 3300026095 Bacteria 1230
60 Ga0268266_10096035 3300028379 Bacteria 2604
61 Ga0265318_10023417 3300028577 Bacteria 2462
62 Ga0265327_10016177 3300031251 Bacteria 4758
63 Ga0265316_10103281 3300031344 Bacteria 2164
64 Ga0307408_100011219 3300031548 Bacteria 5918
65 Ga0307408_100030977 3300031548 Bacteria 3720
66 Ga0307413_10149860 3300031824 Bacteria 1624
67 Ga0307413_10232697 3300031824 Bacteria 1354
68 Ga0307410_10803447 3300031852 Bacteria 800
69 Ga0307406_10053691 3300031901 Bacteria 2568
70 Ga0307406_10081662 3300031901 Bacteria 2150
71 Ga0307406_10352816 3300031901 Bacteria 1150
72 Ga0307407_10007192 3300031903 Bacteria 5023
73 Ga0307412_10611671 3300031911 Bacteria 924
74 Ga0307409_100014520 3300031995 Bacteria 5128
75 Ga0307409_100068706 3300031995 Bacteria 2803
76 Ga0307409_100186725 3300031995 Bacteria 1841
77 Ga0307416_100035947 3300032002 Bacteria 3791
78 Ga0307411_10019004 3300032005 Bacteria 3958
79 Ga0307415_100067247 3300032126 Bacteria 2503
80 Ga0373938_0009141 3300034957 Bacteria 1788
81 Ga0373928_0194845 3300035084 Bacteria 582
82 Ga0373940_0127053 3300035088 Bacteria 796
83 Ga0373962_0036490 3300035242 Bacteria 1369
84 Ga0373927_0083127 3300035695 Bacteria 2076
85 Ga0373933_0178272 3300035724 Bacteria 1355
86 Ga0373937_0079238 3300036401 Bacteria 3036
87 Ga0373937_0115743 3300036401 Bacteria 2497
88 Ga0373925_0169078 3300037068 Bacteria 1725
89 Ga0395900_0866309 3300037418 Bacteria 828
90 Ga0436364_0527483 3300037853 Bacteria 79221
91 Ga0436365_0792124 3300039437 Bacteria 4242
92 Ga0436362_0216841 3300039453 Bacteria 1395
93 Ga0439438_056279 3300041405 Bacteria 991
94 Ga0451853_0308553 3300041512 Bacteria 1707
95 Ga0439441_085446 3300042001 Bacteria 692
96 Ga0439434_0090525 3300042435 Bacteria 978
97 Ga0466963_0386730 3300044694 Bacteria 986
98 Ga0495592_0650130 3300046454 Bacteria 639
99 Ga0495635_0484465 3300046663 Unclassified 815
100 Ga0495588_0178670 3300046674 Bacteria 1122
101 Ga0496102_1758511 3300048905 Unclassified 537
102 Ga0496106_0082113 3300048909 Bacteria 2477
103 Ga0496106_1098006 3300048909 Bacteria 623
104 Ga0496106_1139204 3300048909 Bacteria 610
105 Ga0496108_1037818 3300048911 Unclassified 699
106 Ga0496109_0105393 3300048912 Bacteria 2618
107 Ga0496110_0006717 3300048913 Bacteria 9146
108 Ga0496112_0078972 3300048915 Bacteria 3254
109 Ga0496113_0006744 3300048916 Bacteria 7318
110 Ga0496113_0363272 3300048916 Unclassified 1162
111 Ga0501031_0003613 3300049568 Bacteria 9950
112 Ga0501032_0031878 3300049569 Bacteria 3613
113 Ga0501033_0337144 3300049570 Bacteria 1057
114 Ga0501036_0104454 3300049572 Bacteria 2395
115 Ga0501037_0047690 3300049573 Bacteria 3138
116 Ga0501038_0237660 3300049574 Bacteria 1447
117 Ga0501039_0112983 3300049575 Bacteria 2124
118 Ga0501039_1056969 3300049575 Bacteria 630
119 Ga0501041_0086322 3300049577 Bacteria 1936
120 Ga0501042_0034063 3300049578 Bacteria 3612
121 Ga0501043_0130996 3300049579 Bacteria 1965
122 Ga0501048_0233248 3300049582 Bacteria 1306
123 Ga0501067_0004979 3300049583 Bacteria 7382
124 Ga0501068_0061424 3300049584 Bacteria 2283
125 Ga0501069_0002490 3300049585 Bacteria 9403
126 Ga0501069_0397890 3300049585 Bacteria 815
127 Ga0501070_1171806 3300049586 Bacteria 590
128 Ga0501071_0006398 3300049587 Bacteria 7644
129 Ga0501072_0566874 3300049588 Bacteria 896
130 Ga0501073_0059953 3300049589 Bacteria 2656
131 Ga0501073_0856612 3300049589 Bacteria 626
132 Ga0501074_0494712 3300049590 Bacteria 866
133 Ga0501074_0973807 3300049590 Bacteria 596
134 Ga0501075_1209810 3300049591 Bacteria 573
135 Ga0501079_0055490 3300049741 Bacteria 3057
136 Ga0501079_0217558 3300049741 Bacteria 1492
137 Ga0501080_0452771 3300049742 Bacteria 1150
138 Ga0501080_0863000 3300049742 Bacteria 791
139 Ga0501083_0236557 3300049744 Bacteria 1189
140 Ga0501232_034487 3300049757 Bacteria 719
141 Ga0501045_0013640 3300049824 Bacteria 5744
142 Ga0501045_0638956 3300049824 Bacteria 787
143 nmdc:mga0k408_351112_c1 3300050493 Bacteria 879
144 nmdc:mga0qj67_1018193_c1 3300050509 Bacteria 649
145 nmdc:mga06r32_48919_c1 3300050510 Bacteria 4043
146 nmdc:mga08y16_289727_c1 3300050511 Bacteria 1688
147 Ga0501084_0060158 3300054114 Bacteria 3180
148 Ga0501084_1495032 3300054114 Bacteria 565
149 Ga0501082_0108965 3300060353 Bacteria 2397
150 Ga0501082_0270266 3300060353 Bacteria 1479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_0308553 Ga0451853_0308553_13_441 142
2 3300049586 Ga0501070_1171806 Ga0501070_1171806_137_574 145
3 3300054114 Ga0501084_1495032 Ga0501084_1495032_13_450 145
4 3300031344 Ga0265316_10103281 Ga0265316_101032812 154
5 3300005547 Ga0070693_100129647 Ga0070693_1001296472 155
6 3300035084 Ga0373928_0194845 Ga0373928_0194845_93_563 156
7 3300035242 Ga0373962_0036490 Ga0373962_0036490_461_931 156
8 3300005436 Ga0070713_100699572 Ga0070713_1006995722 159
9 3300006847 Ga0075431_100909928 Ga0075431_1009099281 159
10 3300025928 Ga0207700_10008081 Ga0207700_100080814 159
11 3300009147 Ga0114129_11105932 Ga0114129_111059321 160
12 3300031824 Ga0307413_10232697 Ga0307413_102326972 160
13 3300031901 Ga0307406_10081662 Ga0307406_100816622 160
14 3300031903 Ga0307407_10007192 Ga0307407_100071922 160
15 3300031911 Ga0307412_10611671 Ga0307412_106116711 160
16 3300031995 Ga0307409_100014520 Ga0307409_1000145202 160
17 3300032002 Ga0307416_100035947 Ga0307416_1000359472 160
18 3300032126 Ga0307415_100067247 Ga0307415_1000672472 160
19 3300031852 Ga0307410_10803447 Ga0307410_108034471 162
20 iso_pu_bacteria 2883291878 2883296057 163
21 iso_pu_bacteria 2883354860 2883358814 163
22 3300009551 Ga0105238_10819032 Ga0105238_108190321 164
23 3300048905 Ga0496102_1758511 Ga0496102_1758511_27_524 164
24 3300048911 Ga0496108_1037818 Ga0496108_1037818_110_607 164
25 3300048916 Ga0496113_0363272 Ga0496113_0363272_507_1004 164
26 3300006852 Ga0075433_10913781 Ga0075433_109137812 165
27 3300026075 Ga0207708_10726070 Ga0207708_107260701 165
28 3300034957 Ga0373938_0009141 Ga0373938_0009141_591_1088 165
29 3300042001 Ga0439441_085446 Ga0439441_085446_175_672 165
30 iso_pu_bacteria 2643221554 2643787194 166
31 3300005549 Ga0070704_100674662 Ga0070704_1006746621 167
32 3300009176 Ga0105242_10334577 Ga0105242_103345772 167
33 3300009177 Ga0105248_11048358 Ga0105248_110483582 167
34 3300014968 Ga0157379_10223271 Ga0157379_102232712 167
35 3300025941 Ga0207711_11313550 Ga0207711_113135502 167
36 3300031901 Ga0307406_10352816 Ga0307406_103528162 167
37 3300035088 Ga0373940_0127053 Ga0373940_0127053_72_575 167
38 3300049589 Ga0501073_0856612 Ga0501073_0856612_63_566 167
39 3300049744 Ga0501083_0236557 Ga0501083_0236557_559_1062 167
40 3300025922 Ga0207646_10155070 Ga0207646_101550702 168
41 3300031824 Ga0307413_10149860 Ga0307413_101498602 168
42 3300031995 Ga0307409_100186725 Ga0307409_1001867253 168
43 3300044694 Ga0466963_0386730 Ga0466963_0386730_67_573 168
44 3300046674 Ga0495588_0178670 Ga0495588_0178670_438_944 168
45 3300048909 Ga0496106_1139204 Ga0496106_1139204_88_594 168
46 3300049585 Ga0501069_0397890 Ga0501069_0397890_18_524 168
47 3300006195 Ga0075366_10082847 Ga0075366_100828472 169
48 3300036401 Ga0373937_0115743 Ga0373937_0115743_1852_2361 169
49 3300048909 Ga0496106_0082113 Ga0496106_0082113_653_1162 169
50 3300048909 Ga0496106_1098006 Ga0496106_1098006_69_584 169
51 3300048912 Ga0496109_0105393 Ga0496109_0105393_1922_2431 169
52 3300048913 Ga0496110_0006717 Ga0496110_0006717_5725_6234 169
53 3300048915 Ga0496112_0078972 Ga0496112_0078972_115_624 169
54 3300048916 Ga0496113_0006744 Ga0496113_0006744_6622_7131 169
55 3300049568 Ga0501031_0003613 Ga0501031_0003613_8686_9195 169
56 3300049569 Ga0501032_0031878 Ga0501032_0031878_2396_2905 169
57 3300049570 Ga0501033_0337144 Ga0501033_0337144_327_836 169
58 3300049572 Ga0501036_0104454 Ga0501036_0104454_1856_2365 169
59 3300049573 Ga0501037_0047690 Ga0501037_0047690_1177_1686 169
60 3300049574 Ga0501038_0237660 Ga0501038_0237660_134_643 169
61 3300049575 Ga0501039_0112983 Ga0501039_0112983_1091_1600 169
62 3300049578 Ga0501042_0034063 Ga0501042_0034063_203_712 169
63 3300049579 Ga0501043_0130996 Ga0501043_0130996_955_1464 169
64 3300049583 Ga0501067_0004979 Ga0501067_0004979_1986_2495 169
65 3300049584 Ga0501068_0061424 Ga0501068_0061424_949_1458 169
66 3300049585 Ga0501069_0002490 Ga0501069_0002490_7368_7877 169
67 3300049587 Ga0501071_0006398 Ga0501071_0006398_341_850 169
68 3300049588 Ga0501072_0566874 Ga0501072_0566874_284_793 169
69 3300049589 Ga0501073_0059953 Ga0501073_0059953_1343_1852 169
70 3300049590 Ga0501074_0494712 Ga0501074_0494712_290_808 169
71 3300049590 Ga0501074_0973807 Ga0501074_0973807_59_568 169
72 3300049591 Ga0501075_1209810 Ga0501075_1209810_49_558 169
73 3300049741 Ga0501079_0055490 Ga0501079_0055490_410_919 169
74 3300049742 Ga0501080_0452771 Ga0501080_0452771_342_851 169
75 3300049824 Ga0501045_0013640 Ga0501045_0013640_4786_5295 169
76 3300054114 Ga0501084_0060158 Ga0501084_0060158_2550_3068 169
77 3300060353 Ga0501082_0270266 Ga0501082_0270266_806_1315 169
78 3300005354 Ga0070675_100488863 Ga0070675_1004888631 170
79 3300005467 Ga0070706_100233154 Ga0070706_1002331541 170
80 3300005468 Ga0070707_100045845 Ga0070707_1000458453 170
81 3300005471 Ga0070698_100466340 Ga0070698_1004663402 170
82 3300005536 Ga0070697_100676972 Ga0070697_1006769722 170
83 3300006173 Ga0070716_100120195 Ga0070716_1001201952 170
84 3300006175 Ga0070712_100327268 Ga0070712_1003272681 170
85 3300006237 Ga0097621_100368255 Ga0097621_1003682553 170
86 3300006846 Ga0075430_101347421 Ga0075430_1013474211 170
87 3300011119 Ga0105246_10412725 Ga0105246_104127252 170
88 3300025263 Ga0209565_1002150 Ga0209565_10021508 170
89 3300025298 Ga0209050_1001530 Ga0209050_10015306 170
90 3300025315 Ga0207697_10075306 Ga0207697_100753061 170
91 3300025922 Ga0207646_10194360 Ga0207646_101943603 170
92 3300025926 Ga0207659_10216386 Ga0207659_102163861 170
93 3300028577 Ga0265318_10023417 Ga0265318_100234173 170
94 3300031548 Ga0307408_100011219 Ga0307408_1000112193 170
95 3300031548 Ga0307408_100030977 Ga0307408_1000309773 170
96 3300031901 Ga0307406_10053691 Ga0307406_100536912 170
97 3300035695 Ga0373927_0083127 Ga0373927_0083127_26_583 170
98 3300037068 Ga0373925_0169078 Ga0373925_0169078_551_1063 170
99 3300037418 Ga0395900_0866309 Ga0395900_0866309_133_645 170
100 3300037853 Ga0436364_0527483 Ga0436364_0527483_30308_30826 170
101 3300039453 Ga0436362_0216841 Ga0436362_0216841_372_890 170
102 3300041405 Ga0439438_056279 Ga0439438_056279_128_640 170
103 3300042435 Ga0439434_0090525 Ga0439434_0090525_173_691 170
104 3300046454 Ga0495592_0650130 Ga0495592_0650130_45_557 170
105 3300046663 Ga0495635_0484465 Ga0495635_0484465_14_538 170
106 3300049824 Ga0501045_0638956 Ga0501045_0638956_38_550 170
107 3300050493 nmdc:mga0k408_351112_c1 nmdc:mga0k408_351112_c1_61_579 170
108 3300050509 nmdc:mga0qj67_1018193_c1 nmdc:mga0qj67_1018193_c1_33_551 170
109 3300003781 Ga0055536_1003155 Ga0055536_10031557 171
110 3300003791 Ga0055530_10039329 Ga0055530_100393292 171
111 3300005336 Ga0070680_100400613 Ga0070680_1004006131 171
112 3300005339 Ga0070660_100403277 Ga0070660_1004032772 171
113 3300005340 Ga0070689_100155365 Ga0070689_1001553653 171
114 3300005455 Ga0070663_100247099 Ga0070663_1002470991 171
115 3300005535 Ga0070684_100337072 Ga0070684_1003370722 171
116 3300005546 Ga0070696_100214938 Ga0070696_1002149381 171
117 3300005564 Ga0070664_100210915 Ga0070664_1002109152 171
118 3300005615 Ga0070702_100381929 Ga0070702_1003819292 171
119 3300005617 Ga0068859_100810964 Ga0068859_1008109642 171
120 3300005618 Ga0068864_100453137 Ga0068864_1004531372 171
121 3300005842 Ga0068858_101410946 Ga0068858_1014109461 171
122 3300006847 Ga0075431_100065846 Ga0075431_1000658462 171
123 3300006847 Ga0075431_101258853 Ga0075431_1012588531 171
124 3300006914 Ga0075436_100137971 Ga0075436_1001379711 171
125 3300006931 Ga0097620_100811149 Ga0097620_1008111492 171
126 3300009094 Ga0111539_10114364 Ga0111539_101143642 171
127 3300010375 Ga0105239_10408961 Ga0105239_104089612 171
128 3300021384 Ga0213876_10348388 Ga0213876_103483882 171
129 3300025292 Ga0209676_1000019 Ga0209676_1000019625 171
130 3300025298 Ga0209050_1012056 Ga0209050_10120566 171
131 3300025920 Ga0207649_10510246 Ga0207649_105102462 171
132 3300025928 Ga0207700_10414904 Ga0207700_104149042 171
133 3300025945 Ga0207679_10077219 Ga0207679_100772191 171
134 3300026035 Ga0207703_11710589 Ga0207703_117105891 171
135 3300026067 Ga0207678_10239654 Ga0207678_102396542 171
136 3300026075 Ga0207708_10381981 Ga0207708_103819812 171
137 3300026095 Ga0207676_10437487 Ga0207676_104374872 171
138 3300028379 Ga0268266_10096035 Ga0268266_100960353 171
139 3300031251 Ga0265327_10016177 Ga0265327_100161772 171
140 3300031995 Ga0307409_100068706 Ga0307409_1000687062 171
141 3300032005 Ga0307411_10019004 Ga0307411_100190042 171
142 3300035724 Ga0373933_0178272 Ga0373933_0178272_710_1225 171
143 3300036401 Ga0373937_0079238 Ga0373937_0079238_538_1053 171
144 3300039437 Ga0436365_0792124 Ga0436365_0792124_2561_3076 171
145 3300049575 Ga0501039_1056969 Ga0501039_1056969_94_615 171
146 3300049577 Ga0501041_0086322 Ga0501041_0086322_208_729 171
147 3300049582 Ga0501048_0233248 Ga0501048_0233248_471_992 171
148 3300049741 Ga0501079_0217558 Ga0501079_0217558_328_849 171
149 3300049742 Ga0501080_0863000 Ga0501080_0863000_182_703 171
150 3300049757 Ga0501232_034487 Ga0501232_034487_122_646 171
151 3300050510 nmdc:mga06r32_48919_c1 nmdc:mga06r32_48919_c1_327_860 171
152 3300050511 nmdc:mga08y16_289727_c1 nmdc:mga08y16_289727_c1_123_650 171
153 3300060353 Ga0501082_0108965 Ga0501082_0108965_416_937 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

80

185

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.8271 65 167
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.807 56 167
1nye-assembly3.cif.gz_F crystal structure of osmc from e. coli 0.8068 56 167
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.7856 65 170
2pn2-assembly1.cif.gz_A-2 crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution 0.7843 60 167
ID Description Score Start End Superfamily
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.811 69 168 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8019 66 167 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7944 66 167 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7768 59 170 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7768 70 171 3.30.300.20
ID Description Score Start End GO Terms
AF-X1A9Q2-F1-model_v4 OsmC family protein 0.9289 60 152 GO:0016020
AF-A0A645CV05-F1-model_v4 Protein YhfA 0.9226 59 152
AF-A0A7Y3K9Z4-F1-model_v4 OsmC family protein 0.9183 60 155
AF-A0A6N7G5G7-F1-model_v4 OsmC family peroxiredoxin 0.913 67 158
AF-A0A5C9C3Q5-F1-model_v4 OsmC-like protein 0.9055 59 160

Feature Viewer

pLDDT pTM Quality
83.53 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map