F216635

General Info

Members Datasets Scaffolds Average Seq Length
153 124 145 258

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10054720|Ga0075364_100547202
Length 297
Sequence MVFVALAARRMMCAEPSVRPAVGHVIDSDDGPQDGTQFIGEDMTELVTVEVKDGVQIITINRPQARNAMNLEAAQGVAAALDQLNEDPAIVVAVLTGAGGTFCSGMDLKAFAATGQRPYVGDRGFAGLCEKPPTKPLIAAVEGYAVAGGCELALACDLIVAANNAQFGLPEVRRGLVPGSGGMLRLPRHIPYHIAMELALTGESITAERAYQVGLVNRLSEPGQALHHALDMAHRIAGNGPLAVKTIKGVIAESGDWPVGEMFDRQRPLIAHIFTSDDAREGATAFAEKRPPKWTGR

Samples

Sample ID Description Type Environment
1 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
2 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
3 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
4 2891562705 Microbispora tritici MT50 Isolate Unclassified
5 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
6 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
7 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
61 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
62 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
66 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
72 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
75 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
76 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
77 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
78 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
79 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
80 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
92 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
93 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
116 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
117 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
120 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
121 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
122 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
123 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
124 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.12
Metatranscriptomes 0.65
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.15
Nodule 0
Rhizoplane 2.61
Rhizosphere 79.08
Stem 0
Stem Tuber 0
Unclassified 9.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10007566 3300003911 Bacteria 2005
2 Ga0070683_100572780 3300005329 Bacteria 1080
3 Ga0070670_100577096 3300005331 Bacteria 1005
4 Ga0070680_100139963 3300005336 Bacteria 2029
5 Ga0070680_100567659 3300005336 Bacteria 973
6 Ga0070688_100114037 3300005365 Bacteria 1801
7 Ga0070709_10002477 3300005434 Bacteria 10003
8 Ga0070709_10058803 3300005434 Bacteria 2439
9 Ga0070705_100024645 3300005440 Bacteria 3251
10 Ga0070694_100491733 3300005444 Bacteria 975
11 Ga0070708_100023844 3300005445 Bacteria 5208
12 Ga0070708_100079681 3300005445 Bacteria 2963
13 Ga0070708_100264734 3300005445 Bacteria 1616
14 Ga0070681_10009719 3300005458 Bacteria 9465
15 Ga0070681_10053270 3300005458 Bacteria 4032
16 Ga0070681_10156671 3300005458 Bacteria 2202
17 Ga0070706_100002623 3300005467 Bacteria 18011
18 Ga0070698_100000475 3300005471 Bacteria 42531
19 Ga0070679_100218361 3300005530 Bacteria 1868
20 Ga0070684_100246167 3300005535 Bacteria 1634
21 Ga0068853_100537722 3300005539 Bacteria 1106
22 Ga0070695_100004518 3300005545 Bacteria 8166
23 Ga0070704_100057585 3300005549 Bacteria 2764
24 Ga0068855_100006888 3300005563 Bacteria 13787
25 Ga0068856_100020441 3300005614 Bacteria 6430
26 Ga0068856_100182839 3300005614 Bacteria 2110
27 Ga0068859_100158732 3300005617 Bacteria 2340
28 Ga0068863_100045589 3300005841 Bacteria 4161
29 Ga0068858_100284892 3300005842 Bacteria 1574
30 Ga0081455_10000024 3300005937 Bacteria 157764
31 Ga0081538_10023113 3300005981 Bacteria 4479
32 Ga0081538_10147952 3300005981 Bacteria 1069
33 Ga0081539_10056323 3300005985 Bacteria 2182
34 Ga0070717_10005961 3300006028 Bacteria 8925
35 Ga0075365_10013549 3300006038 Bacteria 4882
36 Ga0075364_10013787 3300006051 Bacteria 4979
37 Ga0075364_10019734 3300006051 Bacteria 4234
38 Ga0075364_10054720 3300006051 Bacteria 2610
39 Ga0075362_10003419 3300006177 Bacteria 5541
40 Ga0075431_100030597 3300006847 Bacteria 5546
41 Ga0075436_100109504 3300006914 Bacteria 1927
42 Ga0097620_100158737 3300006931 Bacteria 2340
43 Ga0114129_10328571 3300009147 Bacteria 2031
44 Ga0105243_10005534 3300009148 Bacteria 9846
45 Ga0105248_10625226 3300009177 Bacteria 1215
46 Ga0163162_10775609 3300013306 Bacteria 1077
47 Ga0157379_10215646 3300014968 Bacteria 1738
48 Ga0157376_10764433 3300014969 Bacteria 976
49 Ga0213872_10100108 3300021361 Bacteria 1293
50 Ga0207684_10053839 3300025910 Bacteria 3414
51 Ga0207707_10025711 3300025912 Bacteria 5150
52 Ga0207707_10041293 3300025912 Bacteria 4029
53 Ga0207695_10114052 3300025913 Bacteria 2678
54 Ga0207646_10010430 3300025922 Bacteria 9082
55 Ga0207646_10377241 3300025922 Bacteria 1281
56 Ga0207644_10214272 3300025931 Bacteria 1524
57 Ga0207667_10001826 3300025949 Bacteria 26774
58 Ga0207658_10072904 3300025986 Bacteria 2605
59 Ga0207658_10670639 3300025986 Bacteria 936
60 Ga0207703_10037467 3300026035 Bacteria 3863
61 Ga0207639_10284501 3300026041 Bacteria 1455
62 Ga0207641_10036607 3300026088 Bacteria 4097
63 Ga0268264_10013490 3300028381 Bacteria 6729
64 Ga0265337_1021825 3300028556 Bacteria 1991
65 Ga0265338_10049121 3300028800 Bacteria 3828
66 Ga0307511_10070710 3300030521 Bacteria 2553
67 Ga0307508_10027919 3300031616 Bacteria 5107
68 Ga0316579_10000279 3300031691 Bacteria 15737
69 Ga0307413_10138124 3300031824 Bacteria 1680
70 Ga0307411_10611701 3300032005 Bacteria 938
71 Ga0316212_1002157 3300033547 Bacteria 2778
72 Ga0372808_007371 3300036459 Bacteria 1502
73 Ga0395900_0016999 3300037418 Bacteria 7424
74 Ga0395900_0052131 3300037418 Bacteria 4212
75 Ga0395900_0184876 3300037418 Bacteria 2116
76 Ga0395898_0000894 3300037466 Bacteria 48455
77 Ga0436361_0284373 3300039447 Bacteria 3364
78 Ga0436361_0378539 3300039447 Bacteria 1487
79 Ga0436363_0359717 3300039450 Bacteria 964
80 Ga0439436_0041540 3300041404 Bacteria 1316
81 Ga0439453_0041412 3300041408 Bacteria 904
82 Ga0451853_3748460 3300041512 Bacteria 3316
83 Ga0439452_028559 3300042010 Bacteria 1390
84 Ga0450898_001654 3300042134 Bacteria 2995
85 Ga0439446_0035997 3300042156 Bacteria 1445
86 Ga0439434_0013062 3300042435 Bacteria 2463
87 Ga0439434_0019180 3300042435 Bacteria 2050
88 Ga0439464_0017706 3300042439 Bacteria 1934
89 Ga0450893_0025960 3300042532 Bacteria 1028
90 Ga0466972_0004753 3300044658 Bacteria 6799
91 Ga0466966_0137001 3300044684 Bacteria 1496
92 Ga0466970_0176147 3300044765 Bacteria 1186
93 Ga0466960_0025048 3300044901 Bacteria 2697
94 Ga0466960_0093186 3300044901 Bacteria 1539
95 Ga0466958_0219136 3300045836 Bacteria 1214
96 Ga0466967_0111560 3300045976 Bacteria 2513
97 Ga0466967_0273883 3300045976 Bacteria 1618
98 Ga0495607_0014895 3300046501 Bacteria 5053
99 Ga0496100_0537599 3300048903 Bacteria 903
100 Ga0496106_0711145 3300048909 Bacteria 800
101 Ga0496112_0479607 3300048915 Bacteria 1180
102 Ga0496115_0019289 3300048918 Bacteria 5248
103 Ga0496121_0210527 3300048924 Bacteria 1378
104 Ga0496122_0134400 3300048925 Bacteria 1563
105 Ga0496124_0000038 3300048927 Bacteria 312485
106 Ga0501031_0000764 3300049568 Bacteria 19335
107 Ga0501031_0095722 3300049568 Bacteria 1937
108 Ga0501032_0030379 3300049569 Bacteria 3707
109 Ga0501033_0007445 3300049570 Bacteria 8526
110 Ga0501033_0102358 3300049570 Bacteria 2089
111 Ga0501034_0022333 3300049571 Bacteria 6448
112 Ga0501036_0000142 3300049572 Bacteria 46404
113 Ga0501037_0000670 3300049573 Bacteria 26232
114 Ga0501037_0147871 3300049573 Bacteria 1680
115 Ga0501038_0001606 3300049574 Bacteria 20982
116 Ga0501041_0168718 3300049577 Bacteria 1369
117 Ga0501043_0001095 3300049579 Bacteria 23800
118 Ga0501046_0003593 3300049580 Bacteria 14205
119 Ga0501046_0185746 3300049580 Bacteria 1552
120 Ga0501047_0002544 3300049581 Bacteria 17375
121 Ga0501047_0258589 3300049581 Bacteria 1589
122 Ga0501047_0400567 3300049581 Bacteria 1205
123 Ga0501048_0054301 3300049582 Bacteria 2846
124 Ga0501067_0043722 3300049583 Bacteria 2489
125 Ga0501068_0373061 3300049584 Bacteria 918
126 Ga0501070_0002098 3300049586 Bacteria 17495
127 Ga0501070_0134355 3300049586 Bacteria 2043
128 Ga0501071_0638340 3300049587 Bacteria 819
129 Ga0501072_0352844 3300049588 Bacteria 1168
130 Ga0501080_0130956 3300049742 Bacteria 2322
131 Ga0501083_0403522 3300049744 Bacteria 889
132 Ga0501035_0004913 3300049822 Bacteria 12685
133 Ga0501044_0000825 3300049823 Bacteria 37302
134 nmdc:mga03683_2958_c1 3300050489 Bacteria 5372
135 nmdc:mga00v17_18405_c1 3300050491 Bacteria 3967
136 nmdc:mga00v17_503_c1 3300050491 Bacteria 10195
137 nmdc:mga00v17_93785_c1 3300050491 Bacteria 1888
138 Ga0495601_0064389 3300053077 Bacteria 2331
139 Ga0495601_0127503 3300053077 Bacteria 1656
140 Ga0495619_0069506 3300053085 Bacteria 2354
141 Ga0500556_0000900 3300053104 Bacteria 16579
142 Ga0500595_089859 3300053119 Bacteria 890
143 Ga0500568_0000194 3300053139 Bacteria 52981
144 Ga0500577_0013145 3300053142 Bacteria 2521
145 Ga0500645_020341 3300053730 Bacteria 2058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044901 Ga0466960_0093186 Ga0466960_0093186_902_1528 208
2 3300048909 Ga0496106_0711145 Ga0496106_0711145_140_784 214
3 3300048915 Ga0496112_0479607 Ga0496112_0479607_44_814 230
4 3300025922 Ga0207646_10010430 Ga0207646_100104304 235
5 3300053077 Ga0495601_0127503 Ga0495601_0127503_854_1621 240
6 3300053085 Ga0495619_0069506 Ga0495619_0069506_1384_2151 240
7 3300006051 Ga0075364_10013787 Ga0075364_100137875 241
8 3300037418 Ga0395900_0052131 Ga0395900_0052131_77_847 241
9 3300037466 Ga0395898_0000894 Ga0395898_0000894_7203_7973 241
10 3300039450 Ga0436363_0359717 Ga0436363_0359717_32_802 245
11 3300049573 Ga0501037_0147871 Ga0501037_0147871_369_1136 245
12 3300049583 Ga0501067_0043722 Ga0501067_0043722_659_1435 246
13 3300005331 Ga0070670_100577096 Ga0070670_1005770961 247
14 3300005365 Ga0070688_100114037 Ga0070688_1001140372 247
15 3300005617 Ga0068859_100158732 Ga0068859_1001587323 247
16 3300005841 Ga0068863_100045589 Ga0068863_1000455893 247
17 3300005842 Ga0068858_100284892 Ga0068858_1002848922 247
18 3300006931 Ga0097620_100158737 Ga0097620_1001587373 247
19 3300009177 Ga0105248_10625226 Ga0105248_106252262 247
20 3300013306 Ga0163162_10775609 Ga0163162_107756092 247
21 3300025986 Ga0207658_10072904 Ga0207658_100729042 247
22 3300026035 Ga0207703_10037467 Ga0207703_100374675 247
23 3300026088 Ga0207641_10036607 Ga0207641_100366073 247
24 3300028381 Ga0268264_10013490 Ga0268264_100134908 247
25 3300039447 Ga0436361_0284373 Ga0436361_0284373_833_1606 247
26 3300049568 Ga0501031_0000764 Ga0501031_0000764_3516_4349 247
27 3300049569 Ga0501032_0030379 Ga0501032_0030379_2450_3283 247
28 3300049570 Ga0501033_0007445 Ga0501033_0007445_7462_8295 247
29 3300049570 Ga0501033_0102358 Ga0501033_0102358_589_1356 247
30 3300049571 Ga0501034_0022333 Ga0501034_0022333_1112_1945 247
31 3300049572 Ga0501036_0000142 Ga0501036_0000142_2844_3677 247
32 3300049573 Ga0501037_0000670 Ga0501037_0000670_17420_18253 247
33 3300049574 Ga0501038_0001606 Ga0501038_0001606_2007_2840 247
34 3300049579 Ga0501043_0001095 Ga0501043_0001095_16743_17576 247
35 3300049580 Ga0501046_0003593 Ga0501046_0003593_3206_4039 247
36 3300049580 Ga0501046_0185746 Ga0501046_0185746_472_1239 247
37 3300049581 Ga0501047_0002544 Ga0501047_0002544_1112_1945 247
38 3300049582 Ga0501048_0054301 Ga0501048_0054301_1095_1928 247
39 3300049586 Ga0501070_0134355 Ga0501070_0134355_102_878 247
40 3300049744 Ga0501083_0403522 Ga0501083_0403522_69_842 247
41 3300049822 Ga0501035_0004913 Ga0501035_0004913_8685_9518 247
42 3300049823 Ga0501044_0000825 Ga0501044_0000825_1659_2492 247
43 3300014969 Ga0157376_10764433 Ga0157376_107644331 248
44 3300048918 Ga0496115_0019289 Ga0496115_0019289_1962_2732 249
45 iso_pu_bacteria 2738543005 2739203872 249
46 iso_pu_bacteria 2928142448 2928145602 249
47 iso_pu_bacteria 2919713450 2919714502 250
48 iso_pu_bacteria 8054472261 8054476678 251
49 3300031824 Ga0307413_10138124 Ga0307413_101381243 252
50 3300005981 Ga0081538_10147952 Ga0081538_101479522 253
51 3300006038 Ga0075365_10013549 Ga0075365_100135494 253
52 3300009148 Ga0105243_10005534 Ga0105243_100055343 253
53 3300031616 Ga0307508_10027919 Ga0307508_100279192 253
54 3300033547 Ga0316212_1002157 Ga0316212_10021572 253
55 3300036459 Ga0372808_007371 Ga0372808_007371_189_1001 253
56 3300041512 Ga0451853_3748460 Ga0451853_3748460_481_1242 253
57 3300045976 Ga0466967_0273883 Ga0466967_0273883_678_1439 253
58 3300046501 Ga0495607_0014895 Ga0495607_0014895_365_1297 253
59 3300049568 Ga0501031_0095722 Ga0501031_0095722_267_1028 253
60 3300049577 Ga0501041_0168718 Ga0501041_0168718_441_1202 253
61 iso_pu_bacteria 2939743619 2939746196 253
62 3300005336 Ga0070680_100567659 Ga0070680_1005676591 254
63 3300005434 Ga0070709_10002477 Ga0070709_100024775 254
64 3300005467 Ga0070706_100002623 Ga0070706_1000026233 254
65 3300005471 Ga0070698_100000475 Ga0070698_10000047533 254
66 3300005614 Ga0068856_100020441 Ga0068856_1000204413 254
67 3300005937 Ga0081455_10000024 Ga0081455_1000002492 254
68 3300005981 Ga0081538_10023113 Ga0081538_100231131 254
69 3300005985 Ga0081539_10056323 Ga0081539_100563232 254
70 3300006028 Ga0070717_10005961 Ga0070717_100059614 254
71 3300006051 Ga0075364_10019734 Ga0075364_100197345 254
72 3300006051 Ga0075364_10054720 Ga0075364_100547202 254
73 3300006177 Ga0075362_10003419 Ga0075362_100034194 254
74 3300006847 Ga0075431_100030597 Ga0075431_1000305972 254
75 3300009147 Ga0114129_10328571 Ga0114129_103285712 254
76 3300014968 Ga0157379_10215646 Ga0157379_102156462 254
77 3300025910 Ga0207684_10053839 Ga0207684_100538392 254
78 3300025931 Ga0207644_10214272 Ga0207644_102142722 254
79 3300025986 Ga0207658_10670639 Ga0207658_106706391 254
80 3300030521 Ga0307511_10070710 Ga0307511_100707102 254
81 3300037418 Ga0395900_0016999 Ga0395900_0016999_802_1569 254
82 3300041404 Ga0439436_0041540 Ga0439436_0041540_364_1128 254
83 3300041408 Ga0439453_0041412 Ga0439453_0041412_115_879 254
84 3300042134 Ga0450898_001654 Ga0450898_001654_1405_2169 254
85 3300042156 Ga0439446_0035997 Ga0439446_0035997_256_1020 254
86 3300042435 Ga0439434_0013062 Ga0439434_0013062_1627_2391 254
87 3300042439 Ga0439464_0017706 Ga0439464_0017706_202_966 254
88 3300042532 Ga0450893_0025960 Ga0450893_0025960_123_914 254
89 3300044901 Ga0466960_0025048 Ga0466960_0025048_1230_1997 254
90 3300045976 Ga0466967_0111560 Ga0466967_0111560_533_1297 254
91 3300048924 Ga0496121_0210527 Ga0496121_0210527_510_1277 254
92 3300048925 Ga0496122_0134400 Ga0496122_0134400_212_979 254
93 3300048927 Ga0496124_0000038 Ga0496124_0000038_86025_86792 254
94 3300049742 Ga0501080_0130956 Ga0501080_0130956_837_1670 254
95 3300050489 nmdc:mga03683_2958_c1 nmdc:mga03683_2958_c1_1422_2213 254
96 3300050491 nmdc:mga00v17_18405_c1 nmdc:mga00v17_18405_c1_204_971 254
97 3300050491 nmdc:mga00v17_503_c1 nmdc:mga00v17_503_c1_5359_6252 254
98 3300050491 nmdc:mga00v17_93785_c1 nmdc:mga00v17_93785_c1_88_855 254
99 3300053104 Ga0500556_0000900 Ga0500556_0000900_11343_12107 254
100 3300053142 Ga0500577_0013145 Ga0500577_0013145_1723_2487 254
101 iso_pu_bacteria 2855386786 2855390316 254
102 iso_pu_bacteria 2856741275 2856746688 254
103 iso_pu_bacteria 2891562705 2891563503 254
104 3300005329 Ga0070683_100572780 Ga0070683_1005727801 255
105 3300005336 Ga0070680_100139963 Ga0070680_1001399632 255
106 3300005434 Ga0070709_10058803 Ga0070709_100588032 255
107 3300005440 Ga0070705_100024645 Ga0070705_1000246452 255
108 3300005444 Ga0070694_100491733 Ga0070694_1004917331 255
109 3300005445 Ga0070708_100023844 Ga0070708_1000238443 255
110 3300005445 Ga0070708_100079681 Ga0070708_1000796812 255
111 3300005445 Ga0070708_100264734 Ga0070708_1002647342 255
112 3300005458 Ga0070681_10009719 Ga0070681_100097199 255
113 3300005458 Ga0070681_10053270 Ga0070681_100532703 255
114 3300005530 Ga0070679_100218361 Ga0070679_1002183612 255
115 3300005535 Ga0070684_100246167 Ga0070684_1002461672 255
116 3300005545 Ga0070695_100004518 Ga0070695_1000045186 255
117 3300005549 Ga0070704_100057585 Ga0070704_1000575852 255
118 3300005614 Ga0068856_100182839 Ga0068856_1001828392 255
119 3300006914 Ga0075436_100109504 Ga0075436_1001095042 255
120 3300021361 Ga0213872_10100108 Ga0213872_101001081 255
121 3300025912 Ga0207707_10025711 Ga0207707_100257112 255
122 3300025912 Ga0207707_10041293 Ga0207707_100412932 255
123 3300025922 Ga0207646_10377241 Ga0207646_103772412 255
124 3300028556 Ga0265337_1021825 Ga0265337_10218251 255
125 3300028800 Ga0265338_10049121 Ga0265338_100491212 255
126 3300031691 Ga0316579_10000279 Ga0316579_100002798 255
127 3300032005 Ga0307411_10611701 Ga0307411_106117011 255
128 3300037418 Ga0395900_0184876 Ga0395900_0184876_1074_1910 255
129 3300039447 Ga0436361_0378539 Ga0436361_0378539_524_1312 255
130 3300042010 Ga0439452_028559 Ga0439452_028559_523_1293 255
131 3300042435 Ga0439434_0019180 Ga0439434_0019180_126_896 255
132 3300044658 Ga0466972_0004753 Ga0466972_0004753_1454_2224 255
133 3300044684 Ga0466966_0137001 Ga0466966_0137001_476_1264 255
134 3300044765 Ga0466970_0176147 Ga0466970_0176147_197_967 255
135 3300045836 Ga0466958_0219136 Ga0466958_0219136_173_943 255
136 3300049581 Ga0501047_0258589 Ga0501047_0258589_773_1561 255
137 3300049584 Ga0501068_0373061 Ga0501068_0373061_44_814 255
138 3300049586 Ga0501070_0002098 Ga0501070_0002098_14680_15453 255
139 3300053077 Ga0495601_0064389 Ga0495601_0064389_1366_2151 255
140 3300053119 Ga0500595_089859 Ga0500595_089859_65_835 255
141 3300053139 Ga0500568_0000194 Ga0500568_0000194_2085_2861 255
142 3300053730 Ga0500645_020341 Ga0500645_020341_656_1426 255
143 3300005458 Ga0070681_10156671 Ga0070681_101566713 256
144 3300005539 Ga0068853_100537722 Ga0068853_1005377222 256
145 3300005563 Ga0068855_100006888 Ga0068855_1000068885 256
146 3300025913 Ga0207695_10114052 Ga0207695_101140523 256
147 3300025949 Ga0207667_10001826 Ga0207667_1000182621 256
148 3300026041 Ga0207639_10284501 Ga0207639_102845012 256
149 3300048903 Ga0496100_0537599 Ga0496100_0537599_53_826 257
150 3300049581 Ga0501047_0400567 Ga0501047_0400567_384_1187 257
151 3300003911 JGI25405J52794_10007566 JGI25405J52794_100075662 264
152 3300049587 Ga0501071_0638340 Ga0501071_0638340_12_806 264
153 3300049588 Ga0501072_0352844 Ga0501072_0352844_276_1070 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

50

297

0.94

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

55

234

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qq3-assembly2.cif.gz_J crystal structure of enoyl-coa hydrates subunit i (gk_2039) other form from geobacillus kaustophilus hta426 0.9622 2 263
2qq3-assembly2.cif.gz_J crystal structure of enoyl-coa hydrates subunit i (gk_2039) other form from geobacillus kaustophilus hta426 0.9585 2 263
3q0g-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa 0.9562 3 261
3h81-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis 0.9554 3 263
3kqf-assembly1.cif.gz_B 1.8 angstrom resolution crystal structure of enoyl-coa hydratase from bacillus anthracis. 0.9544 4 263
ID Description Score Start End Superfamily
4fzwA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.986 206 263 1.10.12.10
4fzwB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9835 206 263 1.10.12.10
5jbwA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9799 205 263 1.10.12.10
af_P76082_198_255_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9769 206 263 1.10.12.10
2zqqC02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9754 205 263 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A6N7FB79-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9868 102 263 GO:0006635
GO:0016829
GO:0016853
AF-A0A0A9I745-F1-model_v4 deleted 0.9849 146 263
AF-A0A7W1LYZ4-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9846 110 263 GO:0006635
GO:0016829
GO:0016853
AF-A0A536HJA5-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9826 102 263 GO:0004300
GO:0006635
AF-W4RKW3-F1-model_v4 Methylglutaconyl-CoA hydratase 0.9785 121 263 GO:0006635
GO:0016829

Feature Viewer

pLDDT pTM Quality
92.89 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map