F216554

General Info

Members Datasets Scaffolds Average Seq Length
153 116 306 157

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10016345|Ga0081455_100163453
Length 143
Sequence MTRLAPGDTAPDFTLPDADGQNVSLKDYRGRKVVVYFYPAAMTPGCTTQACDFRDSLDISPDKPEKLAKFRERDSLTFPLLSDPTREVLEAYGAWGEKTMYGKTVTGVIRSTFVVDADGKLEQAQYGVRAKGHVAKLRRELGV

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
40 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
63 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
70 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
75 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
78 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
79 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
105 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
106 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
107 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
108 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
109 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
110 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
111 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
112 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
113 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
114 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
115 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
116 2891562705 Microbispora tritici MT50 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.81
Metatranscriptomes 1.96
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.92
Nodule 0
Rhizoplane 7.84
Rhizosphere 81.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10016345 3300005937 Bacteria 7169
2 JGI24739J22299_10015533 3300001989 Bacteria 2767
3 JGI24735J21928_10189815 3300002067 Bacteria 595
4 JGI24748J21848_1024561 3300002074 Bacteria 734
5 JGI24034J26672_10020496 3300002239 Bacteria 1036
6 Ga0070658_10056547 3300005327 Bacteria 3189
7 Ga0070658_11003036 3300005327 Bacteria 726
8 Ga0070683_100299595 3300005329 Bacteria 1529
9 Ga0070683_102041316 3300005329 Bacteria 551
10 Ga0070666_10692595 3300005335 Bacteria 747
11 Ga0070680_100839004 3300005336 Bacteria 792
12 Ga0070661_100110586 3300005344 Bacteria 2051
13 Ga0070692_10046845 3300005345 Bacteria 2236
14 Ga0070671_100013346 3300005355 Bacteria 6622
15 Ga0070659_100110388 3300005366 Bacteria 2220
16 Ga0070709_10340225 3300005434 Bacteria 1106
17 Ga0070681_10105120 3300005458 Bacteria 2765
18 Ga0070681_11364637 3300005458 Bacteria 632
19 Ga0070679_100446887 3300005530 Bacteria 1237
20 Ga0070679_100885393 3300005530 Bacteria 836
21 Ga0070684_100012912 3300005535 Bacteria 6714
22 Ga0070684_100152147 3300005535 Bacteria 2096
23 Ga0070684_100752019 3300005535 Bacteria 910
24 Ga0070684_101249646 3300005535 Bacteria 699
25 Ga0070665_100005063 3300005548 Bacteria 13674
26 Ga0070665_100106629 3300005548 Bacteria 2804
27 Ga0068855_100017037 3300005563 Bacteria 8741
28 Ga0068855_100319753 3300005563 Bacteria 1716
29 Ga0068857_100267089 3300005577 Bacteria 1572
30 Ga0081540_1002119 3300005983 Bacteria 16520
31 Ga0070717_10794530 3300006028 Bacteria 861
32 Ga0105244_10014140 3300009036 Bacteria 4628
33 Ga0105244_10019107 3300009036 Bacteria 3833
34 Ga0105240_10604960 3300009093 Bacteria 1206
35 Ga0105245_12121531 3300009098 Bacteria 616
36 Ga0105243_10238166 3300009148 Bacteria 1618
37 Ga0105249_11467857 3300009553 Bacteria 754
38 Ga0157373_10106749 3300013100 Bacteria 1969
39 Ga0157370_10183179 3300013104 Bacteria 1945
40 Ga0157370_10442753 3300013104 Bacteria 1195
41 Ga0157370_10509000 3300013104 Bacteria 1105
42 Ga0157369_10000397 3300013105 Bacteria 58032
43 Ga0157369_10018883 3300013105 Bacteria 7725
44 Ga0157369_10331645 3300013105 Bacteria 1581
45 Ga0157374_10276412 3300013296 Bacteria 1657
46 Ga0157372_10150708 3300013307 Bacteria 2684
47 Ga0157372_10223818 3300013307 Bacteria 2181
48 Ga0157372_10378870 3300013307 Bacteria 1649
49 Ga0157372_12220207 3300013307 Bacteria 630
50 Ga0157375_10775713 3300013308 Bacteria 1109
51 Ga0163163_10822527 3300014325 Bacteria 992
52 Ga0157380_11092798 3300014326 Bacteria 836
53 Ga0206349_1423578 3300020075 Bacteria 832
54 Ga0206354_11226478 3300020081 Bacteria 1050
55 Ga0206353_10491634 3300020082 Bacteria 2802
56 Ga0209759_1041282 3300025256 Bacteria 792
57 Ga0207655_1009129 3300025728 Bacteria 6197
58 Ga0207655_1012275 3300025728 Bacteria 5022
59 Ga0207647_10295744 3300025904 Bacteria 923
60 Ga0207705_10052451 3300025909 Bacteria 2936
61 Ga0207705_10093109 3300025909 Bacteria 2209
62 Ga0207707_10213563 3300025912 Bacteria 1680
63 Ga0207660_10725592 3300025917 Bacteria 811
64 Ga0207657_10046329 3300025919 Bacteria 3809
65 Ga0207649_10736653 3300025920 Bacteria 766
66 Ga0207652_10207840 3300025921 Bacteria 1762
67 Ga0207664_10286293 3300025929 Bacteria 1447
68 Ga0207644_10006201 3300025931 Bacteria 7798
69 Ga0207644_10693789 3300025931 Bacteria 849
70 Ga0207690_10536588 3300025932 Bacteria 950
71 Ga0207709_10008934 3300025935 Bacteria 5531
72 Ga0207661_10575881 3300025944 Bacteria 1032
73 Ga0207661_11558129 3300025944 Bacteria 605
74 Ga0207679_10270957 3300025945 Bacteria 1452
75 Ga0207667_10119587 3300025949 Bacteria 2715
76 Ga0207667_10483138 3300025949 Bacteria 1257
77 Ga0207712_10569798 3300025961 Bacteria 976
78 Ga0207678_10508061 3300026067 Bacteria 1051
79 Ga0268266_10008851 3300028379 Bacteria 8914
80 Ga0268266_10356273 3300028379 Bacteria 1376
81 Ga0268264_10030678 3300028381 Bacteria 4407
82 Ga0265338_10007750 3300028800 Bacteria 13212
83 Ga0265330_10034895 3300031235 Bacteria 2246
84 Ga0265320_10054392 3300031240 Bacteria 1931
85 Ga0265325_10013122 3300031241 Bacteria 4721
86 Ga0265325_10084406 3300031241 Bacteria 1574
87 Ga0265340_10004020 3300031247 Bacteria 8263
88 Ga0265316_10019018 3300031344 Bacteria 5888
89 Ga0307513_10017530 3300031456 Bacteria 8585
90 Ga0265313_10142657 3300031595 Bacteria 1029
91 Ga0265314_10020855 3300031711 Bacteria 5053
92 Ga0265342_10019650 3300031712 Bacteria 4350
93 Ga0316576_10013586 3300031727 Bacteria 5418
94 Ga0316576_10045949 3300031727 Bacteria 3159
95 Ga0316578_10029243 3300031728 Bacteria 3127
96 Ga0307409_100813672 3300031995 Bacteria 943
97 Ga0307416_101534793 3300032002 Bacteria 772
98 Ga0373954_0126197 3300035118 Bacteria 1244
99 Ga0373942_0012874 3300035207 Bacteria 2004
100 Ga0316574_0042524 3300035398 Bacteria 2804
101 Ga0316574_0080640 3300035398 Bacteria 2066
102 Ga0316584_0010310 3300036712 Bacteria 6528
103 Ga0436362_0320745 3300039453 Bacteria 653
104 Ga0451807_0881824 3300041486 Bacteria 584
105 Ga0466972_0046153 3300044658 Bacteria 2110
106 Ga0466966_0164628 3300044684 Bacteria 1349
107 Ga0466961_0042836 3300044693 Bacteria 2901
108 Ga0466963_0116859 3300044694 Bacteria 1833
109 Ga0466963_0809720 3300044694 Bacteria 661
110 Ga0466964_0099440 3300044706 Bacteria 1280
111 Ga0466971_0050253 3300044719 Bacteria 1876
112 Ga0466971_0156663 3300044719 Bacteria 1065
113 Ga0466970_0192028 3300044765 Bacteria 1135
114 Ga0466957_0021819 3300044842 Bacteria 3774
115 Ga0466959_0323939 3300045049 Bacteria 1053
116 Ga0466959_0331480 3300045049 Bacteria 1039
117 Ga0466958_0106772 3300045836 Bacteria 1746
118 Ga0466958_0108946 3300045836 Bacteria 1728
119 Ga0466967_0043557 3300045976 Bacteria 3887
120 Ga0466967_0087138 3300045976 Bacteria 2830
121 Ga0466967_1650143 3300045976 Bacteria 638
122 Ga0495645_0019656 3300046543 Bacteria 4865
123 Ga0496100_0562207 3300048903 Bacteria 883
124 Ga0496102_0690086 3300048905 Bacteria 944
125 Ga0496105_0166265 3300048908 Bacteria 1810
126 Ga0496110_0021553 3300048913 Bacteria 5459
127 Ga0496110_0559805 3300048913 Bacteria 1039
128 Ga0496111_0081110 3300048914 Bacteria 2368
129 Ga0496112_0638377 3300048915 Bacteria 995
130 Ga0496113_0606282 3300048916 Bacteria 877
131 Ga0496114_0016875 3300048917 Bacteria 5888
132 Ga0496114_0031922 3300048917 Bacteria 4333
133 Ga0496114_0425697 3300048917 Bacteria 1176
134 Ga0496126_0097077 3300048929 Bacteria 2583
135 Ga0496126_0104329 3300048929 Bacteria 2477
136 Ga0501040_0328239 3300049576 Bacteria 1095
137 Ga0501070_0014532 3300049586 Bacteria 6624
138 Ga0501081_0059741 3300049743 Bacteria 2640
139 Ga0501045_0241752 3300049824 Bacteria 1344
140 Ga0500643_000290 3300053087 Bacteria 43109
141 Ga0500660_189659 3300053100 Bacteria 726
142 Ga0500559_0012821 3300053136 Bacteria 3557
143 Ga0500573_0001353 3300053140 Bacteria 11651
144 Ga0500573_0158669 3300053140 Bacteria 1232
145 Ga0500620_075595 3300053155 Bacteria 1163
146 2552106422 2551306166 Bacteria 9731570
147 2644198624 2643221635 Bacteria 2632343
148 2812361947 2811994880 Bacteria 4147780
149 2852664715 2852663356 Bacteria 4090475
150 2856746769 2856741275 Bacteria 8096094
151 2891404586 2891395885 Bacteria 9251614
152 2891561749 2891554331 Bacteria 8812224
153 2891565679 2891562705 Bacteria 8039471
154 Ga0081455_10016345
155 JGI24739J22299_10015533
156 JGI24735J21928_10189815
157 JGI24748J21848_1024561
158 JGI24034J26672_10020496
159 Ga0070658_10056547
160 Ga0070658_11003036
161 Ga0070683_100299595
162 Ga0070683_102041316
163 Ga0070666_10692595
164 Ga0070680_100839004
165 Ga0070661_100110586
166 Ga0070692_10046845
167 Ga0070671_100013346
168 Ga0070659_100110388
169 Ga0070709_10340225
170 Ga0070681_10105120
171 Ga0070681_11364637
172 Ga0070679_100446887
173 Ga0070679_100885393
174 Ga0070684_100012912
175 Ga0070684_100152147
176 Ga0070684_100752019
177 Ga0070684_101249646
178 Ga0070665_100005063
179 Ga0070665_100106629
180 Ga0068855_100017037
181 Ga0068855_100319753
182 Ga0068857_100267089
183 Ga0081540_1002119
184 Ga0070717_10794530
185 Ga0105244_10014140
186 Ga0105244_10019107
187 Ga0105240_10604960
188 Ga0105245_12121531
189 Ga0105243_10238166
190 Ga0105249_11467857
191 Ga0157373_10106749
192 Ga0157370_10183179
193 Ga0157370_10442753
194 Ga0157370_10509000
195 Ga0157369_10000397
196 Ga0157369_10018883
197 Ga0157369_10331645
198 Ga0157374_10276412
199 Ga0157372_10150708
200 Ga0157372_10223818
201 Ga0157372_10378870
202 Ga0157372_12220207
203 Ga0157375_10775713
204 Ga0163163_10822527
205 Ga0157380_11092798
206 Ga0206349_1423578
207 Ga0206354_11226478
208 Ga0206353_10491634
209 Ga0209759_1041282
210 Ga0207655_1009129
211 Ga0207655_1012275
212 Ga0207647_10295744
213 Ga0207705_10052451
214 Ga0207705_10093109
215 Ga0207707_10213563
216 Ga0207660_10725592
217 Ga0207657_10046329
218 Ga0207649_10736653
219 Ga0207652_10207840
220 Ga0207664_10286293
221 Ga0207644_10006201
222 Ga0207644_10693789
223 Ga0207690_10536588
224 Ga0207709_10008934
225 Ga0207661_10575881
226 Ga0207661_11558129
227 Ga0207679_10270957
228 Ga0207667_10119587
229 Ga0207667_10483138
230 Ga0207712_10569798
231 Ga0207678_10508061
232 Ga0268266_10008851
233 Ga0268266_10356273
234 Ga0268264_10030678
235 Ga0265338_10007750
236 Ga0265330_10034895
237 Ga0265320_10054392
238 Ga0265325_10013122
239 Ga0265325_10084406
240 Ga0265340_10004020
241 Ga0265316_10019018
242 Ga0307513_10017530
243 Ga0265313_10142657
244 Ga0265314_10020855
245 Ga0265342_10019650
246 Ga0316576_10013586
247 Ga0316576_10045949
248 Ga0316578_10029243
249 Ga0307409_100813672
250 Ga0307416_101534793
251 Ga0373954_0126197
252 Ga0373942_0012874
253 Ga0316574_0042524
254 Ga0316574_0080640
255 Ga0316584_0010310
256 Ga0436362_0320745
257 Ga0451807_0881824
258 Ga0466972_0046153
259 Ga0466966_0164628
260 Ga0466961_0042836
261 Ga0466963_0116859
262 Ga0466963_0809720
263 Ga0466964_0099440
264 Ga0466971_0050253
265 Ga0466971_0156663
266 Ga0466970_0192028
267 Ga0466957_0021819
268 Ga0466959_0323939
269 Ga0466959_0331480
270 Ga0466958_0106772
271 Ga0466958_0108946
272 Ga0466967_0043557
273 Ga0466967_0087138
274 Ga0466967_1650143
275 Ga0495645_0019656
276 Ga0496100_0562207
277 Ga0496102_0690086
278 Ga0496105_0166265
279 Ga0496110_0021553
280 Ga0496110_0559805
281 Ga0496111_0081110
282 Ga0496112_0638377
283 Ga0496113_0606282
284 Ga0496114_0016875
285 Ga0496114_0031922
286 Ga0496114_0425697
287 Ga0496126_0097077
288 Ga0496126_0104329
289 Ga0501040_0328239
290 Ga0501070_0014532
291 Ga0501081_0059741
292 Ga0501045_0241752
293 Ga0500643_000290
294 Ga0500660_189659
295 Ga0500559_0012821
296 Ga0500573_0001353
297 Ga0500573_0158669
298 Ga0500620_075595
299 2552106422
300 2644198624
301 2812361947
302 2852664715
303 2856746769
304 2891404586
305 2891561749
306 2891565679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

6

124

0.97

PF08534

Redoxin

Redoxin

5

141

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9395 4 154
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9322 4 153
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9312 6 154
4eo3-assembly1.cif.gz_B peroxiredoxin nitroreductase fusion enzyme 0.9216 10 154
5imf-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - structure f5 0.9149 5 154
ID Description Score Start End Superfamily
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9962 5 155 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9896 5 155 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9726 5 154 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9588 6 154 3.40.30.10
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.953 14 154 3.40.30.10
ID Description Score Start End GO Terms
AF-K4MJT0-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9976 2 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A6G3HNR1-F1-model_v4 deleted 0.9959 3 99
AF-A0A3C1CM47-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9943 1 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A317CZZ0-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9943 14 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-X5DNZ6-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9939 1 152 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map