F215858

General Info

Members Datasets Scaffolds Average Seq Length
153 125 306 132

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10012725|JGI25153J46596_100127253
Length 132
Sequence VRIVVDSSALVAIGTFEPNRSAFIQAIETASEILISPINYVETGVVLTGRGHFVSREGFDEWLSHYRVRIASEPVIDALALDAYLQFGKGRHPAKLNLADCFAYALAKSLDAPLLYKGDDFPLTDVRSALDV

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
37 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
59 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
62 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
63 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
64 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
65 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
66 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
67 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
68 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
69 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
70 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
71 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
72 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
73 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
74 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
75 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
76 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
77 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
78 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
79 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
80 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
81 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
82 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
83 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
103 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
104 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
105 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
106 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
107 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
108 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
109 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
110 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
111 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
112 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
113 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
114 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
115 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
116 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
119 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
120 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
121 2643221583 Caulobacter sp. Root655 Isolate Unclassified
122 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
123 2818991435 Caulobacter henricii 536 Isolate Unclassified
124 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
125 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.12
Metatranscriptomes 0.65
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.26
Nodule 0
Rhizoplane 0.65
Rhizosphere 67.32
Stem 0
Stem Tuber 0
Unclassified 3.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10012725 3300003215 Bacteria 3606
2 rootH1_10136651 3300003316 Unclassified 1184
3 rootL2_10159660 3300003322 Bacteria 1925
4 rootL2_10257244 3300003322 Bacteria 1437
5 Ga0055537_1010208 3300003773 Bacteria 1998
6 Ga0055524_1020275 3300003775 Bacteria 2245
7 Ga0055531_10001354 3300003794 Bacteria 18239
8 Ga0070658_10163411 3300005327 Bacteria 1868
9 Ga0070666_11213909 3300005335 Bacteria 562
10 Ga0070660_100087498 3300005339 Bacteria 2452
11 Ga0070668_100031139 3300005347 Bacteria 4059
12 Ga0070671_100086643 3300005355 Bacteria 2621
13 Ga0070667_100002297 3300005367 Bacteria 16805
14 Ga0070709_10436579 3300005434 Bacteria 984
15 Ga0070713_101374093 3300005436 Bacteria 685
16 Ga0070697_101182868 3300005536 Bacteria 681
17 Ga0068859_100002155 3300005617 Bacteria 20004
18 Ga0068864_100032247 3300005618 Bacteria 4450
19 Ga0068861_100083278 3300005719 Bacteria 2509
20 Ga0068858_100548548 3300005842 Bacteria 1119
21 Ga0068860_100031515 3300005843 Bacteria 5096
22 Ga0068862_100065889 3300005844 Bacteria 3120
23 Ga0068862_101492424 3300005844 Unclassified 681
24 Ga0070717_11158390 3300006028 Bacteria 704
25 Ga0075362_10134103 3300006177 Bacteria 1180
26 Ga0075370_10638393 3300006353 Bacteria 646
27 Ga0097620_100002155 3300006931 Bacteria 20004
28 Ga0105240_11607170 3300009093 Bacteria 680
29 Ga0105248_10308049 3300009177 Bacteria 1783
30 Ga0105238_10199712 3300009551 Bacteria 1975
31 Ga0105249_10142521 3300009553 Bacteria 2299
32 Ga0105239_12193102 3300010375 Bacteria 642
33 Ga0157380_10619123 3300014326 Bacteria 1074
34 Ga0209565_1000597 3300025263 Bacteria 24336
35 Ga0209673_1001139 3300025273 Bacteria 29248
36 Ga0209675_1023282 3300025291 Bacteria 1607
37 Ga0209564_1066262 3300025295 Bacteria 776
38 Ga0209758_1003966 3300025297 Bacteria 12831
39 Ga0209256_1001399 3300025299 Bacteria 25149
40 Ga0209256_1010111 3300025299 Bacteria 4012
41 Ga0209257_1000186 3300025304 Bacteria 154365
42 Ga0207680_10286058 3300025903 Bacteria 1146
43 Ga0207705_10057019 3300025909 Bacteria 2817
44 Ga0207657_10015163 3300025919 Bacteria 7483
45 Ga0207644_10287126 3300025931 Bacteria 1322
46 Ga0207712_10076570 3300025961 Bacteria 2422
47 Ga0207668_10007229 3300025972 Bacteria 6593
48 Ga0207668_10556199 3300025972 Bacteria 994
49 Ga0207658_10015463 3300025986 Bacteria 5235
50 Ga0207675_100046447 3300026118 Bacteria 4057
51 Ga0209981_1003650 3300027378 Bacteria 1999
52 Ga0210000_1005725 3300027462 Bacteria 1806
53 Ga0209999_1007151 3300027543 Bacteria 2009
54 Ga0268265_10045601 3300028380 Bacteria 3272
55 Ga0268264_10019720 3300028381 Bacteria 5509
56 Ga0265319_1202846 3300028563 Bacteria 608
57 Ga0307515_10016022 3300028794 Bacteria 13759
58 Ga0307515_10045914 3300028794 Bacteria 6694
59 Ga0265338_10025486 3300028800 Bacteria 5999
60 Ga0265338_10318871 3300028800 Bacteria 1125
61 Ga0265760_10175423 3300031090 Bacteria 713
62 Ga0265340_10251260 3300031247 Bacteria 788
63 Ga0307513_10002562 3300031456 Bacteria 25113
64 Ga0307513_10368755 3300031456 Bacteria 1179
65 Ga0307510_10000651 3300033180 Bacteria 35317
66 Ga0373931_0881883 3300035691 Bacteria 600
67 Ga0436364_1516183 3300037853 Bacteria 567
68 Ga0451835_1013893 3300041492 Bacteria 668
69 Ga0451853_0045539 3300041512 Bacteria 1386
70 Ga0451853_2672880 3300041512 Bacteria 713
71 Ga0439442_076662 3300042002 Bacteria 714
72 Ga0439435_0011738 3300042436 Bacteria 2106
73 Ga0495627_001595 3300046453 Bacteria 12715
74 Ga0495638_0008218 3300046460 Bacteria 7416
75 Ga0495650_0000024 3300046471 Bacteria 496674
76 Ga0495596_0128145 3300046500 Bacteria 985
77 Ga0495607_0038762 3300046501 Bacteria 2852
78 Ga0495610_0001081 3300046512 Bacteria 24944
79 Ga0495610_0014991 3300046512 Bacteria 4525
80 Ga0495610_0069300 3300046512 Bacteria 1651
81 Ga0495616_0326404 3300046513 Bacteria 643
82 Ga0495620_0188017 3300046515 Bacteria 797
83 Ga0495620_0369867 3300046515 Bacteria 543
84 Ga0495632_0000940 3300046519 Bacteria 25463
85 Ga0495632_0035822 3300046519 Bacteria 2528
86 Ga0495637_0029769 3300046520 Bacteria 2427
87 Ga0495648_0000861 3300046524 Bacteria 31965
88 Ga0495648_0018818 3300046524 Bacteria 4875
89 Ga0495648_0143594 3300046524 Bacteria 1253
90 Ga0495654_0000118 3300046530 Bacteria 88890
91 Ga0495654_0182438 3300046530 Bacteria 908
92 Ga0495633_0123837 3300046558 Bacteria 1197
93 Ga0495668_0010334 3300046616 Bacteria 5654
94 Ga0495668_0067634 3300046616 Bacteria 1965
95 Ga0495625_0000398 3300046660 Bacteria 66474
96 Ga0495625_0003865 3300046660 Bacteria 14474
97 Ga0495625_0010799 3300046660 Bacteria 7517
98 Ga0495625_0012717 3300046660 Bacteria 6806
99 Ga0495625_0015851 3300046660 Bacteria 5949
100 Ga0495625_0114531 3300046660 Bacteria 1841
101 Ga0495625_0601012 3300046660 Bacteria 660
102 Ga0495670_0639114 3300046691 Bacteria 580
103 Ga0495589_0003780 3300046794 Bacteria 8145
104 Ga0495660_0008391 3300046810 Bacteria 6043
105 Ga0495660_0091034 3300046810 Bacteria 1585
106 Ga0495672_0037134 3300047320 Bacteria 2984
107 Ga0495686_0013327 3300047472 Bacteria 5707
108 Ga0495686_0035928 3300047472 Bacteria 3181
109 Ga0495686_0131829 3300047472 Bacteria 1481
110 Ga0496115_0001809 3300048918 Bacteria 15286
111 Ga0496126_0074970 3300048929 Bacteria 3004
112 Ga0495678_002116 3300049459 Bacteria 14099
113 Ga0501032_0128061 3300049569 Bacteria 1676
114 Ga0501033_0078063 3300049570 Bacteria 2430
115 Ga0501034_0059393 3300049571 Bacteria 3841
116 Ga0501038_0056616 3300049574 Bacteria 3367
117 Ga0501040_0152339 3300049576 Bacteria 1632
118 Ga0501043_0014986 3300049579 Bacteria 6071
119 Ga0501046_0080884 3300049580 Bacteria 2510
120 Ga0501047_0125424 3300049581 Bacteria 2448
121 Ga0501067_0144436 3300049583 Unclassified 1326
122 Ga0501069_0217017 3300049585 Unclassified 1111
123 Ga0501070_0066525 3300049586 Bacteria 2984
124 Ga0501070_0578798 3300049586 Bacteria 897
125 Ga0501073_0272881 3300049589 Unclassified 1167
126 Ga0501035_0482648 3300049822 Bacteria 1022
127 Ga0501044_0007222 3300049823 Bacteria 12218
128 nmdc:mga07m45_39521_c1 3300050496 Bacteria 1494
129 Ga0500578_0000159 3300053086 Bacteria 79246
130 Ga0500578_0409262 3300053086 Bacteria 780
131 Ga0500556_0002967 3300053104 Bacteria 5124
132 Ga0500594_0000108 3300053118 Bacteria 24161
133 Ga0500608_191250 3300053122 Bacteria 856
134 Ga0500614_030798 3300053123 Bacteria 1310
135 Ga0500655_062595 3300053133 Bacteria 751
136 Ga0500559_0000403 3300053136 Bacteria 31068
137 Ga0500564_000247 3300053138 Bacteria 15124
138 Ga0500577_0001424 3300053142 Bacteria 6118
139 Ga0500616_0002003 3300053153 Bacteria 18051
140 Ga0500616_0418586 3300053153 Bacteria 532
141 Ga0500622_0037257 3300053156 Bacteria 2541
142 Ga0500627_0042232 3300053158 Bacteria 1962
143 Ga0500633_0225981 3300053160 Bacteria 698
144 Ga0500645_001367 3300053730 Bacteria 12528
145 Ga0501082_0138545 3300060353 Bacteria 2112
146 2511121023 2510917020 Bacteria 5657507
147 2643747241 2643221545 Bacteria 5083237
148 2643780713 2643221552 Bacteria 5708754
149 2643923064 2643221583 Bacteria 5218014
150 2644507562 2643221691 Bacteria 5093099
151 2819536083 2818991435 Bacteria 5433759
152 2819644476 2818991454 Bacteria 5563326
153 2928531731 2928531327 Bacteria 5101314
154 JGI25153J46596_10012725
155 rootH1_10136651
156 rootL2_10159660
157 rootL2_10257244
158 Ga0055537_1010208
159 Ga0055524_1020275
160 Ga0055531_10001354
161 Ga0070658_10163411
162 Ga0070666_11213909
163 Ga0070660_100087498
164 Ga0070668_100031139
165 Ga0070671_100086643
166 Ga0070667_100002297
167 Ga0070709_10436579
168 Ga0070713_101374093
169 Ga0070697_101182868
170 Ga0068859_100002155
171 Ga0068864_100032247
172 Ga0068861_100083278
173 Ga0068858_100548548
174 Ga0068860_100031515
175 Ga0068862_100065889
176 Ga0068862_101492424
177 Ga0070717_11158390
178 Ga0075362_10134103
179 Ga0075370_10638393
180 Ga0097620_100002155
181 Ga0105240_11607170
182 Ga0105248_10308049
183 Ga0105238_10199712
184 Ga0105249_10142521
185 Ga0105239_12193102
186 Ga0157380_10619123
187 Ga0209565_1000597
188 Ga0209673_1001139
189 Ga0209675_1023282
190 Ga0209564_1066262
191 Ga0209758_1003966
192 Ga0209256_1001399
193 Ga0209256_1010111
194 Ga0209257_1000186
195 Ga0207680_10286058
196 Ga0207705_10057019
197 Ga0207657_10015163
198 Ga0207644_10287126
199 Ga0207712_10076570
200 Ga0207668_10007229
201 Ga0207668_10556199
202 Ga0207658_10015463
203 Ga0207675_100046447
204 Ga0209981_1003650
205 Ga0210000_1005725
206 Ga0209999_1007151
207 Ga0268265_10045601
208 Ga0268264_10019720
209 Ga0265319_1202846
210 Ga0307515_10016022
211 Ga0307515_10045914
212 Ga0265338_10025486
213 Ga0265338_10318871
214 Ga0265760_10175423
215 Ga0265340_10251260
216 Ga0307513_10002562
217 Ga0307513_10368755
218 Ga0307510_10000651
219 Ga0373931_0881883
220 Ga0436364_1516183
221 Ga0451835_1013893
222 Ga0451853_0045539
223 Ga0451853_2672880
224 Ga0439442_076662
225 Ga0439435_0011738
226 Ga0495627_001595
227 Ga0495638_0008218
228 Ga0495650_0000024
229 Ga0495596_0128145
230 Ga0495607_0038762
231 Ga0495610_0001081
232 Ga0495610_0014991
233 Ga0495610_0069300
234 Ga0495616_0326404
235 Ga0495620_0188017
236 Ga0495620_0369867
237 Ga0495632_0000940
238 Ga0495632_0035822
239 Ga0495637_0029769
240 Ga0495648_0000861
241 Ga0495648_0018818
242 Ga0495648_0143594
243 Ga0495654_0000118
244 Ga0495654_0182438
245 Ga0495633_0123837
246 Ga0495668_0010334
247 Ga0495668_0067634
248 Ga0495625_0000398
249 Ga0495625_0003865
250 Ga0495625_0010799
251 Ga0495625_0012717
252 Ga0495625_0015851
253 Ga0495625_0114531
254 Ga0495625_0601012
255 Ga0495670_0639114
256 Ga0495589_0003780
257 Ga0495660_0008391
258 Ga0495660_0091034
259 Ga0495672_0037134
260 Ga0495686_0013327
261 Ga0495686_0035928
262 Ga0495686_0131829
263 Ga0496115_0001809
264 Ga0496126_0074970
265 Ga0495678_002116
266 Ga0501032_0128061
267 Ga0501033_0078063
268 Ga0501034_0059393
269 Ga0501038_0056616
270 Ga0501040_0152339
271 Ga0501043_0014986
272 Ga0501046_0080884
273 Ga0501047_0125424
274 Ga0501067_0144436
275 Ga0501069_0217017
276 Ga0501070_0066525
277 Ga0501070_0578798
278 Ga0501073_0272881
279 Ga0501035_0482648
280 Ga0501044_0007222
281 nmdc:mga07m45_39521_c1
282 Ga0500578_0000159
283 Ga0500578_0409262
284 Ga0500556_0002967
285 Ga0500594_0000108
286 Ga0500608_191250
287 Ga0500614_030798
288 Ga0500655_062595
289 Ga0500559_0000403
290 Ga0500564_000247
291 Ga0500577_0001424
292 Ga0500616_0002003
293 Ga0500616_0418586
294 Ga0500622_0037257
295 Ga0500627_0042232
296 Ga0500633_0225981
297 Ga0500645_001367
298 Ga0501082_0138545
299 2511121023
300 2643747241
301 2643780713
302 2643923064
303 2644507562
304 2819536083
305 2819644476
306 2928531731

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

3

126

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.8944 3 128
4xgq-assembly2.cif.gz_G crystal structure of addiction module from mycobacterial species 0.8922 3 128
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.8555 3 128
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.7988 1 112
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.7718 3 121
ID Description Score Start End Superfamily
af_P9WF57_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9405 4 129 3.40.50.1010
af_P9WF81_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9212 4 129 3.40.50.1010
af_P9WF65_1_129_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.917 4 127 3.40.50.1010
af_P9WF57_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9059 4 129 3.40.50.1010
4xgrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8924 5 129 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A521PNQ4-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9889 3 129 GO:0000287
GO:0004540
GO:0090729
AF-A0A259IWH2-F1-model_v4 deleted 0.9703 25 131
AF-A0A521PNQ4-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9663 3 129 GO:0000287
GO:0004540
GO:0090729
AF-A0A259IWH2-F1-model_v4 deleted 0.9527 25 131
AF-A0A0U5IEJ0-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9427 3 129 GO:0000287
GO:0004540
GO:0090729

Map