F214951

General Info

Members Datasets Scaffolds Average Seq Length
152 119 304 302

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0148072|Ga0395901_0148072_1397_2374
Length 325
Sequence MRLAPDVLVLLPGSGWSWAGAAVGVLCLAGVALVVAGMPMMRRPGLDERLEPYLRDTVRPSRLLATPSNVPAFFGLGTLVAPYVKRLGARVDGVLGGSASVVRRQLRAGQAPDLEAFRAEQVVWGFGGGAVAVVVTGLMAASKGRLSVVLLVLLVFVGAVSGVVARDVQLSRVARRREQRMLSEFPTVAELLALAVSAGEGATGALERVCRLSHGELSDELRRCLADARAGANLPTALEGLARRTGLLSLSRFVDGIVVAVERGTPLAEVLRAQAQDVREEGRRALMEEGARKEIAMMVPVVFLILPVTILFALYPGASFLNFSL

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
10 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
11 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
12 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
13 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
14 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
15 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
16 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
17 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
18 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
19 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
20 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
29 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
30 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
31 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
32 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
33 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
34 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
35 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
38 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
39 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
40 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
41 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
42 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
43 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
46 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
47 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
48 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
49 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
50 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
51 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
52 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
53 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
54 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
55 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
56 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
57 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
58 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
59 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
60 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
61 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
62 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
63 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
64 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
65 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
66 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
67 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
68 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
69 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
70 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
71 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
72 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
73 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
74 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
75 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
85 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
86 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
89 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
90 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
91 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
99 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
100 2506783011 Frankia datiscae Dg1 Isolate Nodule
101 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
102 2643221613 Oerskovia sp. Root22 Isolate Unclassified
103 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
104 2643221679 Angustibacter sp. Root456 Isolate Unclassified
105 2643221711 Terrabacter sp. Root85 Isolate Unclassified
106 2643221721 Oerskovia sp. Root918 Isolate Unclassified
107 2773857933 Frankia sp. BMG5.30 Isolate Nodule
108 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
109 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
110 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
111 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
112 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
113 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
114 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
115 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
116 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
117 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
118 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
119 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.84
Metatranscriptomes 0
Isolates 13.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 1.97
Rhizoplane 13.16
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0148072 3300038443 Bacteria 2467
2 JGI24737J22298_10019719 3300001990 Bacteria 2157
3 Ga0070658_10118242 3300005327 Bacteria 2201
4 Ga0070680_100042714 3300005336 Bacteria 3680
5 Ga0070705_100011176 3300005440 Bacteria 4522
6 Ga0070700_100000075 3300005441 Bacteria 68207
7 Ga0070678_100077517 3300005456 Bacteria 2507
8 Ga0070679_100013637 3300005530 Bacteria 7785
9 Ga0070679_100080071 3300005530 Bacteria 3256
10 Ga0070702_100113475 3300005615 Bacteria 1684
11 Ga0068866_10109296 3300005718 Bacteria 1540
12 Ga0068858_100000045 3300005842 Bacteria 127595
13 Ga0105243_10032915 3300009148 Bacteria 4007
14 Ga0105248_10000220 3300009177 Bacteria 65560
15 Ga0157373_10006775 3300013100 Bacteria 8531
16 Ga0157378_10094834 3300013297 Bacteria 2717
17 Ga0157372_10194225 3300013307 Bacteria 2351
18 Ga0157375_10079815 3300013308 Bacteria 3309
19 Ga0163163_10035077 3300014325 Bacteria 4864
20 Ga0157379_10000006 3300014968 Bacteria 163550
21 Ga0209148_1002268 3300025254 Bacteria 6947
22 Ga0207647_10019727 3300025904 Bacteria 4530
23 Ga0207652_10198661 3300025921 Bacteria 1805
24 Ga0207686_10011954 3300025934 Bacteria 4764
25 Ga0207704_10165645 3300025938 Bacteria 1578
26 Ga0207711_10006483 3300025941 Bacteria 9852
27 Ga0207703_10000009 3300026035 Bacteria 343983
28 Ga0207708_10002565 3300026075 Bacteria 13367
29 Ga0316575_10015351 3300031665 Bacteria 2885
30 Ga0316579_10026110 3300031691 Bacteria 2642
31 Ga0316579_10046347 3300031691 Bacteria 2028
32 Ga0316578_10011524 3300031728 Bacteria 4631
33 Ga0307405_10021429 3300031731 Bacteria 3633
34 Ga0316577_10086192 3300031733 Bacteria 1757
35 Ga0307410_10096281 3300031852 Bacteria 2112
36 Ga0307410_10128668 3300031852 Bacteria 1857
37 Ga0307407_10037911 3300031903 Bacteria 2667
38 Ga0307407_10064291 3300031903 Bacteria 2156
39 Ga0307407_10218315 3300031903 Bacteria 1288
40 Ga0307412_10454900 3300031911 Bacteria 1056
41 Ga0307409_100011188 3300031995 Bacteria 5639
42 Ga0307409_100079374 3300031995 Bacteria 2644
43 Ga0307409_100097317 3300031995 Bacteria 2430
44 Ga0307414_10215306 3300032004 Bacteria 1573
45 Ga0307415_100213227 3300032126 Bacteria 1542
46 Ga0307415_100331651 3300032126 Bacteria 1273
47 Ga0316585_10039663 3300032137 Bacteria 1498
48 Ga0316574_0002394 3300035398 Bacteria 9391
49 Ga0316582_0089629 3300036647 Unclassified 2023
50 Ga0316582_0149469 3300036647 Bacteria 1578
51 Ga0316584_0135089 3300036712 Bacteria 1841
52 Ga0316584_0157297 3300036712 Bacteria 1689
53 Ga0316584_0281254 3300036712 Unclassified 1209
54 Ga0395899_0001259 3300037312 Bacteria 22035
55 Ga0395898_0002677 3300037466 Bacteria 20653
56 Ga0395898_0192443 3300037466 Bacteria 1949
57 Ga0395901_0004307 3300038443 Bacteria 14359
58 Ga0395901_0006298 3300038443 Bacteria 12022
59 Ga0395901_0409045 3300038443 Bacteria 1393
60 Ga0451793_1400650 3300041452 Bacteria 1284
61 Ga0451797_0047973 3300041453 Bacteria 3354
62 Ga0451853_0326396 3300041512 Bacteria 1790
63 Ga0466972_0040171 3300044658 Bacteria 2280
64 Ga0466966_0203652 3300044684 Bacteria 1197
65 Ga0466961_0096062 3300044693 Bacteria 1869
66 Ga0466963_0018882 3300044694 Bacteria 4317
67 Ga0466971_0128823 3300044719 Bacteria 1174
68 Ga0466970_0033960 3300044765 Bacteria 2698
69 Ga0466957_0095593 3300044842 Bacteria 1866
70 Ga0466957_0290452 3300044842 Bacteria 1096
71 Ga0466960_0018526 3300044901 Bacteria 3053
72 Ga0466958_0309845 3300045836 Bacteria 1014
73 Ga0466967_0007545 3300045976 Bacteria 7857
74 Ga0466967_0019406 3300045976 Bacteria 5466
75 Ga0466967_0156223 3300045976 Bacteria 2137
76 Ga0466967_0250119 3300045976 Bacteria 1693
77 Ga0495653_0168383 3300046463 Bacteria 1515
78 Ga0495668_0115555 3300046616 Bacteria 1468
79 Ga0495672_0091845 3300047320 Bacteria 1665
80 Ga0495675_0075031 3300047444 Bacteria 2131
81 Ga0496100_0049547 3300048903 Bacteria 2717
82 Ga0496102_0306218 3300048905 Bacteria 1497
83 Ga0496102_0485255 3300048905 Bacteria 1157
84 Ga0496104_0026769 3300048907 Bacteria 5329
85 Ga0496104_0060880 3300048907 Bacteria 3577
86 Ga0496105_0069619 3300048908 Bacteria 2908
87 Ga0496105_0077784 3300048908 Bacteria 2739
88 Ga0496107_0114186 3300048910 Bacteria 1987
89 Ga0496108_0192540 3300048911 Bacteria 1768
90 Ga0496109_0218231 3300048912 Bacteria 1794
91 Ga0496110_0042638 3300048913 Bacteria 3961
92 Ga0496111_0029457 3300048914 Bacteria 3899
93 Ga0496111_0031983 3300048914 Bacteria 3750
94 Ga0496113_0306900 3300048916 Bacteria 1271
95 Ga0496114_0005842 3300048917 Bacteria 9665
96 Ga0496114_0025081 3300048917 Bacteria 4870
97 Ga0496114_0126403 3300048917 Bacteria 2204
98 Ga0496115_0168592 3300048918 Bacteria 1811
99 Ga0496125_0000075 3300048928 Bacteria 234414
100 Ga0496126_0001674 3300048929 Bacteria 33240
101 Ga0501032_0053586 3300049569 Bacteria 2716
102 Ga0501034_0381363 3300049571 Bacteria 1335
103 Ga0501036_0007010 3300049572 Bacteria 9175
104 Ga0501038_0003462 3300049574 Bacteria 14721
105 Ga0501038_0043864 3300049574 Bacteria 3888
106 Ga0501041_0002930 3300049577 Bacteria 9791
107 Ga0501046_0015765 3300049580 Bacteria 6344
108 Ga0501047_0047182 3300049581 Bacteria 4161
109 Ga0501048_0025010 3300049582 Bacteria 4355
110 Ga0501068_0042990 3300049584 Bacteria 2717
111 Ga0501070_0001061 3300049586 Bacteria 24745
112 Ga0501070_0391594 3300049586 Bacteria 1125
113 Ga0501071_0004821 3300049587 Bacteria 8595
114 Ga0501071_0409489 3300049587 Bacteria 1036
115 Ga0501074_0040909 3300049590 Bacteria 3356
116 Ga0501075_0012418 3300049591 Bacteria 6053
117 Ga0501075_0185674 3300049591 Bacteria 1586
118 Ga0501076_0037546 3300049592 Bacteria 3799
119 Ga0501077_0041289 3300049593 Bacteria 2937
120 Ga0501079_0018941 3300049741 Bacteria 5259
121 Ga0501079_0201600 3300049741 Bacteria 1554
122 Ga0501080_0021376 3300049742 Bacteria 5990
123 Ga0501080_0162162 3300049742 Bacteria 2064
124 Ga0501081_0073338 3300049743 Bacteria 2387
125 Ga0501035_0115534 3300049822 Bacteria 2349
126 Ga0501044_0026660 3300049823 Bacteria 6116
127 Ga0501045_0018932 3300049824 Bacteria 4902
128 Ga0501045_0065477 3300049824 Bacteria 2668
129 Ga0501045_0084060 3300049824 Bacteria 2348
130 Ga0501084_0030062 3300054114 Bacteria 4544
131 Ga0501082_0100462 3300060353 Bacteria 2502
132 Ga0530510_0042332 3300061734 Bacteria 3290
133 2506865674 2506783011 Bacteria 5323186
134 2643853031 2643221567 Bacteria 4163945
135 2644082857 2643221613 Bacteria 4622396
136 2644135520 2643221624 Bacteria 4384879
137 2644445941 2643221679 Bacteria 3839507
138 2644611317 2643221711 Bacteria 4865335
139 2644665814 2643221721 Bacteria 4486924
140 2774903516 2773857933 Bacteria 5818019
141 2808875082 2808606365 Bacteria 4301966
142 2812362066 2811994880 Bacteria 4147780
143 2819424420 2818991318 Bacteria 5266538
144 2819668191 2818991458 Bacteria 4794049
145 2819692034 2818991462 Bacteria 4320267
146 2819729787 2818991469 Bacteria 4644110
147 2835189788 2835188231 Bacteria 3476928
148 2848552907 2848551377 Bacteria 3720646
149 2884994726 2884994152 Bacteria 4492978
150 2919447541 2919446982 Bacteria 3994487
151 2935893224 2935890801 Bacteria 4593001
152 8002787523 8002784119 Bacteria 9788632
153 Ga0395901_0148072
154 JGI24737J22298_10019719
155 Ga0070658_10118242
156 Ga0070680_100042714
157 Ga0070705_100011176
158 Ga0070700_100000075
159 Ga0070678_100077517
160 Ga0070679_100013637
161 Ga0070679_100080071
162 Ga0070702_100113475
163 Ga0068866_10109296
164 Ga0068858_100000045
165 Ga0105243_10032915
166 Ga0105248_10000220
167 Ga0157373_10006775
168 Ga0157378_10094834
169 Ga0157372_10194225
170 Ga0157375_10079815
171 Ga0163163_10035077
172 Ga0157379_10000006
173 Ga0209148_1002268
174 Ga0207647_10019727
175 Ga0207652_10198661
176 Ga0207686_10011954
177 Ga0207704_10165645
178 Ga0207711_10006483
179 Ga0207703_10000009
180 Ga0207708_10002565
181 Ga0316575_10015351
182 Ga0316579_10026110
183 Ga0316579_10046347
184 Ga0316578_10011524
185 Ga0307405_10021429
186 Ga0316577_10086192
187 Ga0307410_10096281
188 Ga0307410_10128668
189 Ga0307407_10037911
190 Ga0307407_10064291
191 Ga0307407_10218315
192 Ga0307412_10454900
193 Ga0307409_100011188
194 Ga0307409_100079374
195 Ga0307409_100097317
196 Ga0307414_10215306
197 Ga0307415_100213227
198 Ga0307415_100331651
199 Ga0316585_10039663
200 Ga0316574_0002394
201 Ga0316582_0089629
202 Ga0316582_0149469
203 Ga0316584_0135089
204 Ga0316584_0157297
205 Ga0316584_0281254
206 Ga0395899_0001259
207 Ga0395898_0002677
208 Ga0395898_0192443
209 Ga0395901_0004307
210 Ga0395901_0006298
211 Ga0395901_0409045
212 Ga0451793_1400650
213 Ga0451797_0047973
214 Ga0451853_0326396
215 Ga0466972_0040171
216 Ga0466966_0203652
217 Ga0466961_0096062
218 Ga0466963_0018882
219 Ga0466971_0128823
220 Ga0466970_0033960
221 Ga0466957_0095593
222 Ga0466957_0290452
223 Ga0466960_0018526
224 Ga0466958_0309845
225 Ga0466967_0007545
226 Ga0466967_0019406
227 Ga0466967_0156223
228 Ga0466967_0250119
229 Ga0495653_0168383
230 Ga0495668_0115555
231 Ga0495672_0091845
232 Ga0495675_0075031
233 Ga0496100_0049547
234 Ga0496102_0306218
235 Ga0496102_0485255
236 Ga0496104_0026769
237 Ga0496104_0060880
238 Ga0496105_0069619
239 Ga0496105_0077784
240 Ga0496107_0114186
241 Ga0496108_0192540
242 Ga0496109_0218231
243 Ga0496110_0042638
244 Ga0496111_0029457
245 Ga0496111_0031983
246 Ga0496113_0306900
247 Ga0496114_0005842
248 Ga0496114_0025081
249 Ga0496114_0126403
250 Ga0496115_0168592
251 Ga0496125_0000075
252 Ga0496126_0001674
253 Ga0501032_0053586
254 Ga0501034_0381363
255 Ga0501036_0007010
256 Ga0501038_0003462
257 Ga0501038_0043864
258 Ga0501041_0002930
259 Ga0501046_0015765
260 Ga0501047_0047182
261 Ga0501048_0025010
262 Ga0501068_0042990
263 Ga0501070_0001061
264 Ga0501070_0391594
265 Ga0501071_0004821
266 Ga0501071_0409489
267 Ga0501074_0040909
268 Ga0501075_0012418
269 Ga0501075_0185674
270 Ga0501076_0037546
271 Ga0501077_0041289
272 Ga0501079_0018941
273 Ga0501079_0201600
274 Ga0501080_0021376
275 Ga0501080_0162162
276 Ga0501081_0073338
277 Ga0501035_0115534
278 Ga0501044_0026660
279 Ga0501045_0018932
280 Ga0501045_0065477
281 Ga0501045_0084060
282 Ga0501084_0030062
283 Ga0501082_0100462
284 Ga0530510_0042332
285 2506865674
286 2643853031
287 2644082857
288 2644135520
289 2644445941
290 2644611317
291 2644665814
292 2774903516
293 2808875082
294 2812362066
295 2819424420
296 2819668191
297 2819692034
298 2819729787
299 2835189788
300 2848552907
301 2884994726
302 2919447541
303 2935893224
304 8002787523

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

188

315

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.7845 169 270
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.7773 169 270
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.7485 169 282
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.7479 169 283
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.7398 169 272
ID Description Score Start End Superfamily
af_O69625_45_175_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7886 176 295 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7845 169 270 1.20.81.30
3c1qB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7578 169 282 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7383 169 270 1.20.81.30
af_O69625_45_175_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7264 176 295 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A7K0LZ45-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9091 81 285 GO:0005886
AF-A0A2C2VEA6-F1-model_v4 Pilus assembly protein TadC 0.884 85 310 GO:0005886
AF-A0A4Y4DUF1-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8763 99 313 GO:0005886
AF-A0A657IUY6-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.875 96 310 GO:0005886
AF-A0A536RCE1-F1-model_v4 Type II secretion system F family protein 0.8728 91 308 GO:0005886

Map