F214935

General Info

Members Datasets Scaffolds Average Seq Length
152 71 151 306

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0085526|Ga0395905_0085526_284_1324
Length 346
Sequence VPPGAGKSATCGNGGGVSKPESRATHKTFARAVGAVNQHAMEKVQYQGQTLTRWRVGKSTFLALPEKGARLMNWNLTLGDGSVRDVLYWPEDADFANIAKVRGGNPILFPFNGRSFDRGEIYFWRAADGVKRAMPMHGIARQGDFKVSSLDARGFTAHFLPGDEAKQCYPFDYDFSVTYRFEPLGLLCEFSLTNLGKEPLPWSAGHHFYFTLPWSEGTKRSDYLIRIPAGKRMRQDATGALIAGPQLQPDESIGNPVLLDTLHMGLRSNEVVFGEKGRPGDVVMRLGAAKVPDPNATFVTWTLSDESPFYCVEPWMGPPNAAEHKVGLHLVAPGETQKFAVTVNVR

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
15 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
16 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
17 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
24 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
25 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
26 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
27 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
28 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
29 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
30 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
31 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
32 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
33 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
34 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
35 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
36 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
37 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
38 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
39 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
40 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
41 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
44 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
45 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
46 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
53 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
58 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
69 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
70 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
71 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.37
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10003184 3300003320 Bacteria 8786
2 rootH1_10309307 3300003323 Unclassified 1863
3 Ga0068869_100000048 3300005334 Bacteria 50814
4 Ga0070713_100059540 3300005436 Bacteria 3190
5 Ga0068867_100000269 3300005459 Bacteria 34206
6 Ga0070684_100215381 3300005535 Bacteria 1751
7 Ga0068853_100527010 3300005539 Bacteria 1117
8 Ga0068855_100204775 3300005563 Bacteria 2220
9 Ga0068857_100009868 3300005577 Bacteria 8291
10 Ga0068856_100001531 3300005614 Bacteria 24224
11 Ga0068856_100086946 3300005614 Bacteria 3107
12 Ga0070717_10002071 3300006028 Bacteria 14041
13 Ga0097621_100010985 3300006237 Bacteria 6651
14 Ga0068871_100007103 3300006358 Bacteria 7984
15 Ga0068865_100039673 3300006881 Bacteria 3195
16 Ga0157369_10122137 3300013105 Bacteria 2763
17 Ga0207700_10047116 3300025928 Bacteria 3193
18 Ga0207689_10000731 3300025942 Bacteria 31579
19 Ga0207677_10085310 3300026023 Bacteria 2279
20 Ga0207702_10001191 3300026078 Bacteria 26401
21 Ga0207702_10172014 3300026078 Bacteria 1987
22 Ga0207648_10002825 3300026089 Bacteria 18422
23 Ga0207674_10045516 3300026116 Bacteria 4513
24 Ga0265337_1001096 3300028556 Bacteria 13911
25 Ga0265337_1003326 3300028556 Bacteria 7007
26 Ga0265337_1004530 3300028556 Bacteria 5745
27 Ga0265337_1018087 3300028556 Bacteria 2246
28 Ga0265337_1026396 3300028556 Unclassified 1760
29 Ga0265319_1001111 3300028563 Bacteria 16724
30 Ga0265319_1001864 3300028563 Bacteria 12010
31 Ga0265319_1002869 3300028563 Bacteria 9214
32 Ga0265319_1003926 3300028563 Bacteria 7557
33 Ga0265319_1007856 3300028563 Bacteria 4740
34 Ga0265319_1013865 3300028563 Bacteria 3185
35 Ga0265319_1049630 3300028563 Bacteria 1389
36 Ga0265334_10001225 3300028573 Bacteria 12543
37 Ga0265334_10005581 3300028573 Bacteria 5497
38 Ga0265334_10043258 3300028573 Unclassified 1753
39 Ga0265318_10000007 3300028577 Bacteria 280699
40 Ga0265318_10000802 3300028577 Bacteria 20838
41 Ga0265318_10001098 3300028577 Bacteria 16993
42 Ga0265318_10020837 3300028577 Bacteria 2639
43 Ga0265318_10023423 3300028577 Bacteria 2461
44 Ga0265318_10075058 3300028577 Bacteria 1251
45 Ga0265323_10000387 3300028653 Bacteria 25382
46 Ga0265323_10003184 3300028653 Bacteria 7311
47 Ga0265323_10003818 3300028653 Bacteria 6563
48 Ga0265323_10009490 3300028653 Bacteria 3971
49 Ga0265323_10036735 3300028653 Bacteria 1799
50 Ga0265323_10056244 3300028653 Bacteria 1380
51 Ga0265322_10003144 3300028654 Bacteria 5028
52 Ga0265336_10001496 3300028666 Bacteria 10575
53 Ga0265336_10017677 3300028666 Bacteria 2320
54 Ga0265338_10003113 3300028800 Bacteria 23744
55 Ga0265338_10007582 3300028800 Bacteria 13406
56 Ga0265338_10041228 3300028800 Bacteria 4321
57 Ga0265338_10244951 3300028800 Bacteria 1326
58 Ga0265324_10000864 3300029957 Bacteria 19468
59 Ga0265324_10009225 3300029957 Bacteria 3861
60 Ga0265324_10054160 3300029957 Unclassified 1377
61 Ga0265330_10020544 3300031235 Bacteria 3017
62 Ga0265330_10064472 3300031235 Unclassified 1591
63 Ga0265330_10098629 3300031235 Bacteria 1252
64 Ga0265332_10035770 3300031238 Bacteria 2156
65 Ga0265332_10098637 3300031238 Unclassified 1233
66 Ga0265328_10080853 3300031239 Bacteria 1197
67 Ga0265320_10000528 3300031240 Bacteria 29615
68 Ga0265320_10000557 3300031240 Bacteria 28713
69 Ga0265320_10011946 3300031240 Bacteria 5083
70 Ga0265320_10013701 3300031240 Bacteria 4649
71 Ga0265320_10014334 3300031240 Bacteria 4518
72 Ga0265320_10019863 3300031240 Bacteria 3660
73 Ga0265320_10040359 3300031240 Bacteria 2328
74 Ga0265325_10001742 3300031241 Bacteria 15095
75 Ga0265325_10029157 3300031241 Unclassified 2968
76 Ga0265329_10046906 3300031242 Unclassified 1380
77 Ga0265329_10053416 3300031242 Bacteria 1284
78 Ga0265340_10078152 3300031247 Bacteria 1561
79 Ga0265339_10017752 3300031249 Bacteria 4207
80 Ga0265331_10003421 3300031250 Bacteria 10266
81 Ga0265331_10004299 3300031250 Bacteria 8923
82 Ga0265331_10007319 3300031250 Bacteria 6394
83 Ga0265331_10082198 3300031250 Bacteria 1495
84 Ga0265327_10002371 3300031251 Bacteria 20068
85 Ga0265327_10002902 3300031251 Bacteria 17213
86 Ga0265327_10006267 3300031251 Bacteria 9582
87 Ga0265327_10007869 3300031251 Bacteria 8095
88 Ga0265327_10051140 3300031251 Bacteria 2158
89 Ga0265316_10022633 3300031344 Bacteria 5292
90 Ga0265316_10032644 3300031344 Bacteria 4247
91 Ga0265316_10062200 3300031344 Bacteria 2898
92 Ga0265316_10063970 3300031344 Bacteria 2850
93 Ga0265316_10100156 3300031344 Unclassified 2203
94 Ga0265316_10210714 3300031344 Unclassified 1437
95 Ga0307408_100000003 3300031548 Bacteria 618438
96 Ga0265313_10000016 3300031595 Bacteria 154004
97 Ga0265313_10001630 3300031595 Bacteria 20838
98 Ga0265313_10002584 3300031595 Bacteria 15437
99 Ga0265313_10003071 3300031595 Bacteria 13845
100 Ga0265313_10003765 3300031595 Bacteria 12042
101 Ga0265313_10006688 3300031595 Bacteria 8078
102 Ga0265314_10002589 3300031711 Bacteria 18305
103 Ga0265314_10003827 3300031711 Bacteria 14367
104 Ga0265314_10078564 3300031711 Bacteria 2184
105 Ga0265314_10097551 3300031711 Unclassified 1898
106 Ga0265342_10005392 3300031712 Bacteria 9766
107 Ga0265342_10023926 3300031712 Unclassified 3859
108 Ga0265342_10027150 3300031712 Bacteria 3582
109 Ga0265342_10027847 3300031712 Unclassified 3525
110 Ga0265342_10051796 3300031712 Bacteria 2448
111 Ga0265342_10108771 3300031712 Bacteria 1571
112 Ga0307410_10000009 3300031852 Bacteria 91471
113 Ga0307407_10016975 3300031903 Bacteria 3639
114 Ga0307412_10007995 3300031911 Bacteria 6029
115 Ga0307409_100000005 3300031995 Bacteria 84226
116 Ga0307416_100000275 3300032002 Bacteria 27144
117 Ga0307416_100131678 3300032002 Bacteria 2253
118 Ga0307411_10188796 3300032005 Bacteria 1571
119 Ga0373951_0045265 3300035091 Unclassified 1070
120 Ga0395905_0085526 3300037471 Bacteria 2955
121 Ga0451853_1881452 3300041512 Bacteria 1416
122 Ga0451577_0000025 3300042876 Bacteria 403632
123 Ga0451577_0146737 3300042876 Bacteria 2122
124 Ga0451577_0254017 3300042876 Bacteria 1591
125 Ga0453683_0168045 3300044673 Unclassified 1389
126 Ga0466961_0062475 3300044693 Bacteria 2367
127 Ga0453684_0000045 3300044712 Bacteria 582917
128 Ga0453684_0025061 3300044712 Bacteria 8679
129 Ga0453684_0150310 3300044712 Bacteria 2769
130 Ga0451576_0000396 3300045051 Bacteria 101504
131 Ga0451576_0001157 3300045051 Bacteria 47541
132 Ga0451576_0005861 3300045051 Bacteria 15262
133 Ga0451576_0148769 3300045051 Bacteria 2442
134 Ga0451576_0481908 3300045051 Unclassified 1303
135 Ga0466967_0040666 3300045976 Bacteria 4004
136 Ga0501032_0007198 3300049569 Bacteria 8137
137 Ga0501032_0155036 3300049569 Bacteria 1505
138 Ga0501033_0010068 3300049570 Bacteria 7254
139 Ga0501037_0029837 3300049573 Bacteria 4029
140 Ga0501039_0517469 3300049575 Unclassified 937
141 Ga0501046_0000333 3300049580 Bacteria 47539
142 Ga0501046_0035372 3300049580 Bacteria 4026
143 Ga0501047_0020448 3300049581 Bacteria 6356
144 Ga0501047_0022437 3300049581 Bacteria 6062
145 Ga0501047_0121702 3300049581 Bacteria 2491
146 Ga0501243_002729 3300049675 Bacteria 2601
147 Ga0501080_0020772 3300049742 Bacteria 6080
148 Ga0501083_0002381 3300049744 Bacteria 12871
149 Ga0501083_0002418 3300049744 Bacteria 12764
150 Ga0501035_0014600 3300049822 Bacteria 7250
151 Ga0501035_0094907 3300049822 Bacteria 2622

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0517469 Ga0501039_0517469_42_872 269
2 3300041512 Ga0451853_1881452 Ga0451853_1881452_382_1305 286
3 3300031548 Ga0307408_100000003 Ga0307408_100000003490 293
4 3300031852 Ga0307410_10000009 Ga0307410_1000000933 293
5 3300031903 Ga0307407_10016975 Ga0307407_100169751 293
6 3300031911 Ga0307412_10007995 Ga0307412_100079952 293
7 3300031995 Ga0307409_100000005 Ga0307409_10000000525 293
8 3300032002 Ga0307416_100000275 Ga0307416_10000027523 293
9 3300032005 Ga0307411_10188796 Ga0307411_101887962 293
10 3300049569 Ga0501032_0155036 Ga0501032_0155036_470_1390 294
11 3300049580 Ga0501046_0035372 Ga0501046_0035372_1651_2571 294
12 3300049581 Ga0501047_0020448 Ga0501047_0020448_1827_2747 294
13 3300049822 Ga0501035_0094907 Ga0501035_0094907_683_1603 294
14 iso_pu_bacteria 2786546940 2788432985 296
15 3300005535 Ga0070684_100215381 Ga0070684_1002153812 298
16 3300005563 Ga0068855_100204775 Ga0068855_1002047753 298
17 3300005614 Ga0068856_100086946 Ga0068856_1000869463 298
18 3300013105 Ga0157369_10122137 Ga0157369_101221372 298
19 3300026078 Ga0207702_10172014 Ga0207702_101720142 298
20 3300005334 Ga0068869_100000048 Ga0068869_10000004827 299
21 3300005459 Ga0068867_100000269 Ga0068867_10000026924 299
22 3300005539 Ga0068853_100527010 Ga0068853_1005270101 299
23 3300006237 Ga0097621_100010985 Ga0097621_1000109853 299
24 3300006358 Ga0068871_100007103 Ga0068871_1000071037 299
25 3300006881 Ga0068865_100039673 Ga0068865_1000396733 299
26 3300025942 Ga0207689_10000731 Ga0207689_100007315 299
27 3300026023 Ga0207677_10085310 Ga0207677_100853102 299
28 3300026089 Ga0207648_10002825 Ga0207648_1000282515 299
29 3300028556 Ga0265337_1001096 Ga0265337_100109611 299
30 3300028556 Ga0265337_1003326 Ga0265337_10033263 299
31 3300028556 Ga0265337_1004530 Ga0265337_10045303 299
32 3300028556 Ga0265337_1026396 Ga0265337_10263962 299
33 3300028563 Ga0265319_1001111 Ga0265319_10011117 299
34 3300028563 Ga0265319_1001864 Ga0265319_100186412 299
35 3300028563 Ga0265319_1002869 Ga0265319_10028699 299
36 3300028563 Ga0265319_1003926 Ga0265319_10039262 299
37 3300028563 Ga0265319_1007856 Ga0265319_10078562 299
38 3300028563 Ga0265319_1013865 Ga0265319_10138653 299
39 3300028573 Ga0265334_10001225 Ga0265334_100012253 299
40 3300028573 Ga0265334_10043258 Ga0265334_100432582 299
41 3300028577 Ga0265318_10000007 Ga0265318_10000007203 299
42 3300028577 Ga0265318_10000802 Ga0265318_100008028 299
43 3300028577 Ga0265318_10001098 Ga0265318_100010987 299
44 3300028577 Ga0265318_10020837 Ga0265318_100208372 299
45 3300028577 Ga0265318_10023423 Ga0265318_100234233 299
46 3300028577 Ga0265318_10075058 Ga0265318_100750581 299
47 3300028666 Ga0265336_10001496 Ga0265336_100014966 299
48 3300028800 Ga0265338_10003113 Ga0265338_1000311313 299
49 3300028800 Ga0265338_10007582 Ga0265338_1000758213 299
50 3300029957 Ga0265324_10000864 Ga0265324_100008649 299
51 3300029957 Ga0265324_10009225 Ga0265324_100092253 299
52 3300031238 Ga0265332_10035770 Ga0265332_100357703 299
53 3300031238 Ga0265332_10098637 Ga0265332_100986371 299
54 3300031239 Ga0265328_10080853 Ga0265328_100808532 299
55 3300031240 Ga0265320_10000528 Ga0265320_1000052812 299
56 3300031240 Ga0265320_10000557 Ga0265320_1000055726 299
57 3300031240 Ga0265320_10011946 Ga0265320_100119467 299
58 3300031240 Ga0265320_10013701 Ga0265320_100137013 299
59 3300031240 Ga0265320_10014334 Ga0265320_100143343 299
60 3300031240 Ga0265320_10019863 Ga0265320_100198634 299
61 3300031241 Ga0265325_10001742 Ga0265325_100017423 299
62 3300031241 Ga0265325_10029157 Ga0265325_100291572 299
63 3300031242 Ga0265329_10053416 Ga0265329_100534161 299
64 3300031247 Ga0265340_10078152 Ga0265340_100781522 299
65 3300031249 Ga0265339_10017752 Ga0265339_100177521 299
66 3300031250 Ga0265331_10003421 Ga0265331_100034216 299
67 3300031250 Ga0265331_10004299 Ga0265331_100042993 299
68 3300031250 Ga0265331_10007319 Ga0265331_100073197 299
69 3300031250 Ga0265331_10082198 Ga0265331_100821982 299
70 3300031251 Ga0265327_10002371 Ga0265327_1000237111 299
71 3300031251 Ga0265327_10002902 Ga0265327_1000290212 299
72 3300031344 Ga0265316_10062200 Ga0265316_100622003 299
73 3300031344 Ga0265316_10100156 Ga0265316_101001563 299
74 3300031344 Ga0265316_10210714 Ga0265316_102107142 299
75 3300031595 Ga0265313_10000016 Ga0265313_1000001625 299
76 3300031595 Ga0265313_10001630 Ga0265313_1000163013 299
77 3300031595 Ga0265313_10002584 Ga0265313_100025849 299
78 3300031595 Ga0265313_10003071 Ga0265313_1000307113 299
79 3300031595 Ga0265313_10003765 Ga0265313_100037659 299
80 3300031595 Ga0265313_10006688 Ga0265313_100066882 299
81 3300031711 Ga0265314_10002589 Ga0265314_1000258912 299
82 3300031711 Ga0265314_10003827 Ga0265314_1000382712 299
83 3300031711 Ga0265314_10078564 Ga0265314_100785643 299
84 3300031711 Ga0265314_10097551 Ga0265314_100975512 299
85 3300031712 Ga0265342_10023926 Ga0265342_100239262 299
86 3300031712 Ga0265342_10027150 Ga0265342_100271505 299
87 3300031712 Ga0265342_10027847 Ga0265342_100278473 299
88 3300032002 Ga0307416_100131678 Ga0307416_1001316781 299
89 3300037471 Ga0395905_0085526 Ga0395905_0085526_284_1324 299
90 3300042876 Ga0451577_0000025 Ga0451577_0000025_323508_324428 299
91 3300042876 Ga0451577_0146737 Ga0451577_0146737_1080_2045 299
92 3300044693 Ga0466961_0062475 Ga0466961_0062475_928_1848 299
93 3300044712 Ga0453684_0025061 Ga0453684_0025061_2408_3409 299
94 3300045051 Ga0451576_0000396 Ga0451576_0000396_19785_20705 299
95 3300045051 Ga0451576_0005861 Ga0451576_0005861_7125_8045 299
96 3300045051 Ga0451576_0148769 Ga0451576_0148769_322_1242 299
97 3300045051 Ga0451576_0481908 Ga0451576_0481908_334_1254 299
98 3300049569 Ga0501032_0007198 Ga0501032_0007198_1398_2318 299
99 3300049570 Ga0501033_0010068 Ga0501033_0010068_2921_3841 299
100 3300049573 Ga0501037_0029837 Ga0501037_0029837_788_1708 299
101 3300049580 Ga0501046_0000333 Ga0501046_0000333_40771_41691 299
102 3300049581 Ga0501047_0022437 Ga0501047_0022437_846_1766 299
103 3300049581 Ga0501047_0121702 Ga0501047_0121702_176_1096 299
104 3300049742 Ga0501080_0020772 Ga0501080_0020772_2035_2955 299
105 3300049822 Ga0501035_0014600 Ga0501035_0014600_5621_6541 299
106 3300003320 rootH2_10003184 rootH2_100031846 300
107 3300003323 rootH1_10309307 rootH1_103093071 300
108 3300005436 Ga0070713_100059540 Ga0070713_1000595404 300
109 3300005577 Ga0068857_100009868 Ga0068857_1000098687 300
110 3300005614 Ga0068856_100001531 Ga0068856_10000153121 300
111 3300006028 Ga0070717_10002071 Ga0070717_100020714 300
112 3300025928 Ga0207700_10047116 Ga0207700_100471164 300
113 3300026078 Ga0207702_10001191 Ga0207702_100011917 300
114 3300026116 Ga0207674_10045516 Ga0207674_100455162 300
115 3300028556 Ga0265337_1018087 Ga0265337_10180871 300
116 3300028563 Ga0265319_1049630 Ga0265319_10496302 300
117 3300028573 Ga0265334_10005581 Ga0265334_100055816 300
118 3300028653 Ga0265323_10000387 Ga0265323_1000038712 300
119 3300028653 Ga0265323_10003184 Ga0265323_100031843 300
120 3300028653 Ga0265323_10003818 Ga0265323_100038182 300
121 3300028653 Ga0265323_10009490 Ga0265323_100094903 300
122 3300028653 Ga0265323_10036735 Ga0265323_100367352 300
123 3300028653 Ga0265323_10056244 Ga0265323_100562441 300
124 3300028654 Ga0265322_10003144 Ga0265322_100031445 300
125 3300028666 Ga0265336_10017677 Ga0265336_100176772 300
126 3300028800 Ga0265338_10041228 Ga0265338_100412286 300
127 3300028800 Ga0265338_10244951 Ga0265338_102449511 300
128 3300029957 Ga0265324_10054160 Ga0265324_100541602 300
129 3300031235 Ga0265330_10020544 Ga0265330_100205443 300
130 3300031235 Ga0265330_10064472 Ga0265330_100644723 300
131 3300031235 Ga0265330_10098629 Ga0265330_100986292 300
132 3300031240 Ga0265320_10040359 Ga0265320_100403593 300
133 3300031242 Ga0265329_10046906 Ga0265329_100469061 300
134 3300031251 Ga0265327_10006267 Ga0265327_100062675 300
135 3300031251 Ga0265327_10007869 Ga0265327_1000786911 300
136 3300031251 Ga0265327_10051140 Ga0265327_100511402 300
137 3300031344 Ga0265316_10022633 Ga0265316_100226333 300
138 3300031344 Ga0265316_10032644 Ga0265316_100326442 300
139 3300031344 Ga0265316_10063970 Ga0265316_100639703 300
140 3300031712 Ga0265342_10005392 Ga0265342_100053923 300
141 3300031712 Ga0265342_10051796 Ga0265342_100517962 300
142 3300031712 Ga0265342_10108771 Ga0265342_101087711 300
143 3300035091 Ga0373951_0045265 Ga0373951_0045265_39_962 300
144 3300042876 Ga0451577_0254017 Ga0451577_0254017_229_1152 300
145 3300044673 Ga0453683_0168045 Ga0453683_0168045_415_1338 300
146 3300044712 Ga0453684_0000045 Ga0453684_0000045_14371_15294 300
147 3300044712 Ga0453684_0150310 Ga0453684_0150310_1528_2454 300
148 3300045051 Ga0451576_0001157 Ga0451576_0001157_38993_39919 300
149 3300045976 Ga0466967_0040666 Ga0466967_0040666_1122_2045 300
150 3300049675 Ga0501243_002729 Ga0501243_002729_936_1859 300
151 3300049744 Ga0501083_0002381 Ga0501083_0002381_3071_3994 300
152 3300049744 Ga0501083_0002418 Ga0501083_0002418_619_1542 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01263

Aldose_epim

Aldose 1-epimerase

52

344

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k25-assembly2.cif.gz_B crystal structure of slr1438 protein from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr112 0.7892 1 300
3dcd-assembly2.cif.gz_B x-ray structure of the galactose mutarotase related enzyme q5fkd7 from lactobacillus acidophilus at the resolution 1.9a. northeast structural genomics consortium target lar33. 0.7843 11 300
3q1n-assembly1.cif.gz_A crystal structure of a galactose mutarotase-like protein (lsei_2598) from lactobacillus casei atcc 334 at 1.61 a resolution 0.783 11 300
3k25-assembly2.cif.gz_B crystal structure of slr1438 protein from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr112 0.7815 1 300
3mwx-assembly2.cif.gz_B crystal structure of a putative galactose mutarotase (bsu18360) from bacillus subtilis at 1.45 a resolution 0.7788 2 300
ID Description Score Start End Superfamily
af_B8A1H0_29_315_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8231 8 300 2.70.98.10
3k25A00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8215 11 300 2.70.98.10
3os7B00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.7889 2 300 2.70.98.10
af_X2JAD3_2_284_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.7873 11 298 2.70.98.10
3os7B00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.7841 2 300 2.70.98.10
ID Description Score Start End GO Terms
AF-A0A1J5TXX9-F1-model_v4 Aldose 1-epimerase 0.9838 1 300 GO:0005975
GO:0016853
GO:0030246
AF-A0A6N6PKV1-F1-model_v4 deleted 0.9815 1 300
AF-A0A1J5TXX9-F1-model_v4 Aldose 1-epimerase 0.9806 1 300 GO:0005975
GO:0016853
GO:0030246
AF-A0A6N6PKV1-F1-model_v4 deleted 0.9783 1 300
AF-A0A651H443-F1-model_v4 Aldose epimerase 0.9713 1 298 GO:0005975
GO:0016853
GO:0030246

Feature Viewer

pLDDT pTM Quality
92.32 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map