F214807

General Info

Members Datasets Scaffolds Average Seq Length
152 106 304 219

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10068986|Ga0307414_100689862
Length 251
Sequence LHELHRTKRLAQIKLIACTSVIGVTKNKNMKPPKKHSFFYRNSLSLVFLLIFLVTLGAQAYAGWKEHNRELQDNNAKELNFSTYLKSGHFISATFENFESEFLQMALYVLLTVKLRQLGSAESKSLDEEEEVDREPVPSEDAPWAVKKGGWILKLYSNSLGIAFFILFFVSWSIHLYGSWQDHNVEQILNNKPKDDVLSFLTQPTFWFETFQNWQSEFLSVLAIVFLTIYLRQKGSPESKPVDAPHMETGK

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
41 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
42 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
60 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
61 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
64 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
65 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
66 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
67 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
68 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
69 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
75 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
76 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
77 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
78 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
79 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
80 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
81 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
82 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
83 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
84 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
85 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
86 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
87 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
88 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
89 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
90 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
91 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
92 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
93 2739367656 Pedobacter sp. CF523 Isolate Unclassified
94 2818991437 Pedobacter terrae 518 Isolate Unclassified
95 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
96 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
97 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
98 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
99 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
100 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
101 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
102 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
103 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
104 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
105 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
106 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.47
Metatranscriptomes 0
Isolates 10.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.18
Nodule 0
Rhizoplane 0.66
Rhizosphere 82.24
Stem 0
Stem Tuber 0
Unclassified 3.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10068986 3300032004 Bacteria 2539
2 SwRhRL2b_contig_2244174 2162886007 Bacteria 28845
3 SwRhRL2b_contig_902721 2162886007 Bacteria 13539
4 JGI24740J21852_10005525 3300001979 Bacteria 5331
5 JGI25150J39212_1000029 3300002774 Bacteria 103974
6 JGI25151J46595_10000003 3300003187 Bacteria 715330
7 JGI25153J46596_10000111 3300003215 Bacteria 92915
8 rootH1_10071092 3300003323 Bacteria 16096
9 Ga0055536_1000012 3300003781 Bacteria 263217
10 Ga0055530_10001806 3300003791 Bacteria 14844
11 Ga0065165_1000023 3300005262 Bacteria 251942
12 Ga0065714_10002245 3300005288 Bacteria 36818
13 Ga0065714_10003975 3300005288 Bacteria 5693
14 Ga0065714_10007626 3300005288 Bacteria 6094
15 Ga0065714_10142908 3300005288 Bacteria 1158
16 Ga0065704_10000199 3300005289 Bacteria 297176
17 Ga0065704_10000366 3300005289 Bacteria 27408
18 Ga0065712_10033449 3300005290 Bacteria 1243
19 Ga0070669_100125232 3300005353 Bacteria 1965
20 Ga0070671_100177127 3300005355 Bacteria 1805
21 Ga0070673_100303458 3300005364 Unclassified 1406
22 Ga0070662_100087828 3300005457 Bacteria 2329
23 Ga0068867_100106061 3300005459 Bacteria 2152
24 Ga0070672_100853852 3300005543 Bacteria 803
25 Ga0068855_100327155 3300005563 Bacteria 1693
26 Ga0081538_10032813 3300005981 Bacteria 3469
27 Ga0081539_10001426 3300005985 Bacteria 41076
28 Ga0075431_100073797 3300006847 Bacteria 3520
29 Ga0105244_10083588 3300009036 Bacteria 1577
30 Ga0111539_10070610 3300009094 Bacteria 4123
31 Ga0105249_10040048 3300009553 Bacteria 4256
32 Ga0157373_10000015 3300013100 Bacteria 183381
33 Ga0157373_10000357 3300013100 Bacteria 36805
34 Ga0157373_10011186 3300013100 Bacteria 6603
35 Ga0157371_10003696 3300013102 Bacteria 13734
36 Ga0157371_10041278 3300013102 Bacteria 3293
37 Ga0157370_10005208 3300013104 Bacteria 14652
38 Ga0157370_10038797 3300013104 Bacteria 4607
39 Ga0157370_10070164 3300013104 Bacteria 3308
40 Ga0157370_10109803 3300013104 Bacteria 2578
41 Ga0157370_10237566 3300013104 Bacteria 1686
42 Ga0157370_10249243 3300013104 Bacteria 1643
43 Ga0157370_10328848 3300013104 Bacteria 1409
44 Ga0157369_10000004 3300013105 Bacteria 479764
45 Ga0163162_10060026 3300013306 Bacteria 3836
46 Ga0157372_10217612 3300013307 Bacteria 2214
47 Ga0157375_10272225 3300013308 Bacteria 1856
48 Ga0157380_10012859 3300014326 Bacteria 6083
49 Ga0157380_10061177 3300014326 Bacteria 3012
50 Ga0182008_10052142 3300014497 Bacteria 2028
51 Ga0182008_10053416 3300014497 Bacteria 2000
52 Ga0157377_10060299 3300014745 Bacteria 2165
53 Ga0157376_10508259 3300014969 Bacteria 1185
54 Ga0182006_1000135 3300015261 Bacteria 79175
55 Ga0182006_1000359 3300015261 Bacteria 38054
56 Ga0182006_1000559 3300015261 Bacteria 27908
57 Ga0182006_1008979 3300015261 Bacteria 4505
58 Ga0182006_1027681 3300015261 Bacteria 2311
59 Ga0182007_10000010 3300015262 Bacteria 286070
60 Ga0182007_10000027 3300015262 Bacteria 167235
61 Ga0182007_10051470 3300015262 Bacteria 1358
62 Ga0207425_1000004 3300025245 Bacteria 1092421
63 Ga0209129_1000005 3300025258 Bacteria 777812
64 Ga0209676_1000001 3300025292 Bacteria 1852142
65 Ga0209676_1000229 3300025292 Bacteria 122052
66 Ga0209025_1000009 3300025294 Bacteria 1092561
67 Ga0209758_1000010 3300025297 Bacteria 1092782
68 Ga0209050_1000018 3300025298 Bacteria 723263
69 Ga0207644_10055473 3300025931 Bacteria 2856
70 Ga0207706_10093817 3300025933 Bacteria 2640
71 Ga0207675_100093034 3300026118 Bacteria 2835
72 Ga0209974_10011503 3300027876 Bacteria 2970
73 Ga0209974_10058503 3300027876 Bacteria 1303
74 Ga0316181_1167664 3300030744 Bacteria 1687
75 Ga0316181_1186404 3300030744 Bacteria 29194
76 Ga0307408_100010387 3300031548 Bacteria 6139
77 Ga0307405_10000013 3300031731 Bacteria 227563
78 Ga0307413_10184328 3300031824 Bacteria 1492
79 Ga0307407_10000024 3300031903 Bacteria 113716
80 Ga0307412_10000009 3300031911 Bacteria 445987
81 Ga0307412_10000033 3300031911 Bacteria 206649
82 Ga0307412_10009106 3300031911 Bacteria 5689
83 Ga0307412_10040116 3300031911 Bacteria 3028
84 Ga0307412_10045874 3300031911 Bacteria 2860
85 Ga0307409_100006180 3300031995 Bacteria 7006
86 Ga0307409_100052321 3300031995 Bacteria 3130
87 Ga0307409_100889841 3300031995 Bacteria 903
88 Ga0307416_100000037 3300032002 Bacteria 137513
89 Ga0307416_100002446 3300032002 Bacteria 10663
90 Ga0307416_100526715 3300032002 Bacteria 1251
91 Ga0307414_10000662 3300032004 Bacteria 17629
92 Ga0307414_10000667 3300032004 Bacteria 17585
93 Ga0307414_10006481 3300032004 Bacteria 6527
94 Ga0307414_10014823 3300032004 Bacteria 4687
95 Ga0307414_10046999 3300032004 Bacteria 2967
96 Ga0307414_10062224 3300032004 Bacteria 2647
97 Ga0307414_10519532 3300032004 Bacteria 1056
98 Ga0307414_10624025 3300032004 Bacteria 969
99 Ga0307411_10260261 3300032005 Bacteria 1370
100 Ga0439457_018184 3300042014 Bacteria 1561
101 Ga0450893_0018997 3300042532 Unclassified 1174
102 Ga0466982_0085543 3300044672 Bacteria 1954
103 Ga0451576_0007212 3300045051 Bacteria 13391
104 Ga0495606_0005453 3300046507 Bacteria 12179
105 Ga0495616_0084946 3300046513 Bacteria 1508
106 Ga0495668_0000489 3300046616 Bacteria 49613
107 Ga0495625_0000527 3300046660 Bacteria 56317
108 Ga0495687_002020 3300047443 Bacteria 17170
109 Ga0496114_0106093 3300048917 Unclassified 2403
110 Ga0501038_0517459 3300049574 Bacteria 911
111 Ga0501039_0253210 3300049575 Bacteria 1384
112 Ga0501041_0027109 3300049577 Bacteria 3452
113 Ga0501046_0125068 3300049580 Bacteria 1954
114 Ga0501048_0049692 3300049582 Bacteria 2989
115 Ga0501072_0221792 3300049588 Bacteria 1507
116 Ga0501075_0157775 3300049591 Bacteria 1730
117 Ga0501076_0095471 3300049592 Bacteria 2395
118 Ga0501076_0858632 3300049592 Bacteria 748
119 Ga0501077_0000951 3300049593 Bacteria 17462
120 Ga0501077_0017894 3300049593 Bacteria 4479
121 Ga0501261_007825 3300049690 Bacteria 1375
122 Ga0501079_0032039 3300049741 Bacteria 4040
123 Ga0501241_007157 3300049758 Bacteria 2046
124 Ga0501045_0196482 3300049824 Bacteria 1503
125 Ga0501045_0747712 3300049824 Bacteria 721
126 nmdc:mga06r32_128508_c1 3300050510 Bacteria 2504
127 nmdc:mga08y16_252352_c1 3300050511 Bacteria 1823
128 Ga0500556_0015623 3300053104 Unclassified 2346
129 Ga0500658_0234597 3300053134 Bacteria 842
130 Ga0500616_0000685 3300053153 Bacteria 39676
131 Ga0500627_0126248 3300053158 Bacteria 1155
132 Ga0501084_0042119 3300054114 Bacteria 3819
133 Ga0501084_0145754 3300054114 Bacteria 1994
134 Ga0590071_025685 3300059421 Unclassified 1397
135 Ga0590077_002692 3300059426 Unclassified 3750
136 Ga0501082_0040208 3300060353 Bacteria 4034
137 2586210562 2585427687 Bacteria 5544917
138 2739616396 2739367656 Bacteria 5152243
139 2819546089 2818991437 Bacteria 5805520
140 2842723086 2842722452 Bacteria 6263924
141 2842903853 2842903701 Bacteria 6986368
142 2842914043 2842909656 Bacteria 6185908
143 2852623259 2852623160 Bacteria 4376875
144 2852627412 2852627209 Bacteria 5896285
145 2852628860 2852627209 Bacteria 5896285
146 2857628634 2857627736 Bacteria 5625397
147 2884937872 2884933994 Bacteria 4535041
148 2919191248 2919186247 Bacteria 6244071
149 2929925301 2929921140 Bacteria 8649150
150 2939669527 2939664404 Bacteria 6364494
151 2945999157 2945997725 Bacteria 6404843
152 2954018245 2954016120 Bacteria 6446024
153 Ga0307414_10068986
154 SwRhRL2b_contig_2244174
155 SwRhRL2b_contig_902721
156 JGI24740J21852_10005525
157 JGI25150J39212_1000029
158 JGI25151J46595_10000003
159 JGI25153J46596_10000111
160 rootH1_10071092
161 Ga0055536_1000012
162 Ga0055530_10001806
163 Ga0065165_1000023
164 Ga0065714_10002245
165 Ga0065714_10003975
166 Ga0065714_10007626
167 Ga0065714_10142908
168 Ga0065704_10000199
169 Ga0065704_10000366
170 Ga0065712_10033449
171 Ga0070669_100125232
172 Ga0070671_100177127
173 Ga0070673_100303458
174 Ga0070662_100087828
175 Ga0068867_100106061
176 Ga0070672_100853852
177 Ga0068855_100327155
178 Ga0081538_10032813
179 Ga0081539_10001426
180 Ga0075431_100073797
181 Ga0105244_10083588
182 Ga0111539_10070610
183 Ga0105249_10040048
184 Ga0157373_10000015
185 Ga0157373_10000357
186 Ga0157373_10011186
187 Ga0157371_10003696
188 Ga0157371_10041278
189 Ga0157370_10005208
190 Ga0157370_10038797
191 Ga0157370_10070164
192 Ga0157370_10109803
193 Ga0157370_10237566
194 Ga0157370_10249243
195 Ga0157370_10328848
196 Ga0157369_10000004
197 Ga0163162_10060026
198 Ga0157372_10217612
199 Ga0157375_10272225
200 Ga0157380_10012859
201 Ga0157380_10061177
202 Ga0182008_10052142
203 Ga0182008_10053416
204 Ga0157377_10060299
205 Ga0157376_10508259
206 Ga0182006_1000135
207 Ga0182006_1000359
208 Ga0182006_1000559
209 Ga0182006_1008979
210 Ga0182006_1027681
211 Ga0182007_10000010
212 Ga0182007_10000027
213 Ga0182007_10051470
214 Ga0207425_1000004
215 Ga0209129_1000005
216 Ga0209676_1000001
217 Ga0209676_1000229
218 Ga0209025_1000009
219 Ga0209758_1000010
220 Ga0209050_1000018
221 Ga0207644_10055473
222 Ga0207706_10093817
223 Ga0207675_100093034
224 Ga0209974_10011503
225 Ga0209974_10058503
226 Ga0316181_1167664
227 Ga0316181_1186404
228 Ga0307408_100010387
229 Ga0307405_10000013
230 Ga0307413_10184328
231 Ga0307407_10000024
232 Ga0307412_10000009
233 Ga0307412_10000033
234 Ga0307412_10009106
235 Ga0307412_10040116
236 Ga0307412_10045874
237 Ga0307409_100006180
238 Ga0307409_100052321
239 Ga0307409_100889841
240 Ga0307416_100000037
241 Ga0307416_100002446
242 Ga0307416_100526715
243 Ga0307414_10000662
244 Ga0307414_10000667
245 Ga0307414_10006481
246 Ga0307414_10014823
247 Ga0307414_10046999
248 Ga0307414_10062224
249 Ga0307414_10519532
250 Ga0307414_10624025
251 Ga0307411_10260261
252 Ga0439457_018184
253 Ga0450893_0018997
254 Ga0466982_0085543
255 Ga0451576_0007212
256 Ga0495606_0005453
257 Ga0495616_0084946
258 Ga0495668_0000489
259 Ga0495625_0000527
260 Ga0495687_002020
261 Ga0496114_0106093
262 Ga0501038_0517459
263 Ga0501039_0253210
264 Ga0501041_0027109
265 Ga0501046_0125068
266 Ga0501048_0049692
267 Ga0501072_0221792
268 Ga0501075_0157775
269 Ga0501076_0095471
270 Ga0501076_0858632
271 Ga0501077_0000951
272 Ga0501077_0017894
273 Ga0501261_007825
274 Ga0501079_0032039
275 Ga0501241_007157
276 Ga0501045_0196482
277 Ga0501045_0747712
278 nmdc:mga06r32_128508_c1
279 nmdc:mga08y16_252352_c1
280 Ga0500556_0015623
281 Ga0500658_0234597
282 Ga0500616_0000685
283 Ga0500627_0126248
284 Ga0501084_0042119
285 Ga0501084_0145754
286 Ga0590071_025685
287 Ga0590077_002692
288 Ga0501082_0040208
289 2586210562
290 2739616396
291 2819546089
292 2842723086
293 2842903853
294 2842914043
295 2852623259
296 2852627412
297 2852628860
298 2857628634
299 2884937872
300 2919191248
301 2929925301
302 2939669527
303 2945999157
304 2954018245

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20554

DUF6766

Domain of unknown function (DUF6766)

35

251

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e9x-assembly2.cif.gz_E the crystal structure of human gins core complex 0.4315 120 214
5o0t-assembly1.cif.gz_A crystal structure of trans-membrane domain of cylindrospermum stagnale nadph-oxidase 5 (nox5) 0.4193 10 209
8c7c-assembly1.cif.gz_M double mutant v(m84)c/a(l278)c structure of photosynthetic reaction center from cereibacter sphaeroides strain rv 0.349 110 214
5o0t-assembly1.cif.gz_A crystal structure of trans-membrane domain of cylindrospermum stagnale nadph-oxidase 5 (nox5) 0.3356 10 209
4kx6-assembly2.cif.gz_O plasticity of the quinone-binding site of the complex ii homolog quinol:fumarate reductase 0.3176 116 205
ID Description Score Start End Superfamily
af_A0A0P0YBY4_33_209_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4748 117 209 1.20.1250.20
af_Q5SX79_610_798_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4281 6 192 1.10.287.1490
af_M0R7P4_23_315_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3984 114 208 1.20.1070.10
af_Q5SX79_610_798_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3855 6 192 1.10.287.1490
4kx6O00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.3176 116 205 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A519KHZ1-F1-model_v4 Transmembrane protein 0.9716 10 223 GO:0016020
AF-A0A7K2HWB7-F1-model_v4 Transmembrane protein 0.9691 10 223 GO:0016020
AF-A0A1Q3TSD0-F1-model_v4 Transmembrane protein 0.969 7 220 GO:0016020
AF-A0A4U3KZV2-F1-model_v4 Transmembrane protein 0.9689 10 223 GO:0016020
AF-A0A1G8XXN4-F1-model_v4 Uncharacterized protein 0.9685 10 223 GO:0016020

Map