F214803

General Info

Members Datasets Scaffolds Average Seq Length
152 107 304 127

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100698786|Ga0307409_1006987862
Length 147
Sequence VARLYQLRMSTMLFMALDIRLDHSIVAVSDWETSNRFYRDVVGAQLVPHGEPPRVAYRLGDTQLNVHGPRVDLSSNVAKLPVQPGNSDLCFVWPGPIEGATAHLARHGIQVETGPVTRLGARGEGISVYFRDPDGSLLEFISYESRG

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
30 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
31 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
39 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
40 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
46 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
47 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
48 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
49 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
52 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
55 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
56 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
57 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
58 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
59 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
60 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
61 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
62 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
63 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
64 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
65 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
66 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
67 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
68 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
69 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
70 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
86 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
87 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
90 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
91 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
99 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.21
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 19.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100698786 3300031995 Unclassified 1013
2 Ga0070683_100021459 3300005329 Bacteria 5766
3 Ga0070682_100385021 3300005337 Bacteria 1056
4 Ga0070668_100883692 3300005347 Bacteria 798
5 Ga0070671_100211566 3300005355 Bacteria 1645
6 Ga0070663_100277363 3300005455 Bacteria 1335
7 Ga0068867_101306416 3300005459 Unclassified 670
8 Ga0070699_100255452 3300005518 Bacteria 1567
9 Ga0070684_100124098 3300005535 Bacteria 2324
10 Ga0070672_101019260 3300005543 Unclassified 734
11 Ga0070664_100696511 3300005564 Bacteria 946
12 Ga0068861_100963374 3300005719 Bacteria 812
13 Ga0068870_10353785 3300005840 Bacteria 943
14 Ga0081455_10251974 3300005937 Bacteria 1291
15 Ga0081455_10394001 3300005937 Bacteria 963
16 Ga0081538_10038090 3300005981 Unclassified 3108
17 Ga0081538_10218649 3300005981 Unclassified 758
18 Ga0081540_1000700 3300005983 Bacteria 31234
19 Ga0081539_10166793 3300005985 Bacteria 1045
20 Ga0097621_101617342 3300006237 Bacteria 616
21 Ga0075431_100058111 3300006847 Bacteria 3990
22 Ga0075433_11356133 3300006852 Unclassified 616
23 Ga0075434_100051207 3300006871 Bacteria 4103
24 Ga0068865_101080990 3300006881 Bacteria 706
25 Ga0111539_10107691 3300009094 Bacteria 3270
26 Ga0111539_10244201 3300009094 Bacteria 2090
27 Ga0105245_10392781 3300009098 Bacteria 1384
28 Ga0105243_10229434 3300009148 Bacteria 1646
29 Ga0157371_10553173 3300013102 Bacteria 853
30 Ga0157380_10613333 3300014326 Unclassified 1079
31 Ga0182008_10060420 3300014497 Unclassified 1868
32 Ga0182008_10812354 3300014497 Bacteria 544
33 Ga0182006_1215590 3300015261 Bacteria 633
34 Ga0182007_10157683 3300015262 Bacteria 775
35 Ga0207709_10229301 3300025935 Bacteria 1344
36 Ga0207661_10393105 3300025944 Bacteria 1256
37 Ga0207679_11094247 3300025945 Bacteria 731
38 Ga0207668_11053721 3300025972 Bacteria 728
39 Ga0207683_11410666 3300026121 Unclassified 644
40 Ga0207428_10094518 3300027907 Unclassified 2317
41 Ga0207428_10440412 3300027907 Bacteria 951
42 Ga0265327_10297946 3300031251 Bacteria 710
43 Ga0307409_100792829 3300031995 Bacteria 954
44 Ga0307409_101757853 3300031995 Bacteria 649
45 Ga0307416_100996800 3300032002 Bacteria 941
46 Ga0307415_100432995 3300032126 Bacteria 1132
47 Ga0395899_0016131 3300037312 Bacteria 5696
48 Ga0395899_0055844 3300037312 Bacteria 2920
49 Ga0395900_0051129 3300037418 Bacteria 4257
50 Ga0395900_0365579 3300037418 Bacteria 1413
51 Ga0395900_0431017 3300037418 Viruses 1278
52 Ga0395900_0691557 3300037418 Unclassified 954
53 Ga0395900_1064387 3300037418 Bacteria 727
54 Ga0395898_0051561 3300037466 Bacteria 4023
55 Ga0395898_0260895 3300037466 Bacteria 1653
56 Ga0395898_0423605 3300037466 Unclassified 1268
57 Ga0395898_0530879 3300037466 Bacteria 1118
58 Ga0395905_0102748 3300037471 Unclassified 2683
59 Ga0395905_0148464 3300037471 Bacteria 2205
60 Ga0395905_1204658 3300037471 Viruses 661
61 Ga0395905_1468187 3300037471 Bacteria 586
62 Ga0395901_0083322 3300038443 Bacteria 3342
63 Ga0395901_0257472 3300038443 Bacteria 1817
64 Ga0395901_0366198 3300038443 Bacteria 1485
65 Ga0395901_1298044 3300038443 Unclassified 690
66 Ga0451789_0577841 3300041443 Bacteria 809
67 Ga0451802_0292660 3300041460 Bacteria 2005
68 Ga0451804_0402529 3300041463 Bacteria 953
69 Ga0451851_0608076 3300041507 Unclassified 647
70 Ga0451853_2869338 3300041512 Bacteria 1341
71 Ga0466963_0182791 3300044694 Bacteria 1464
72 Ga0466963_0299549 3300044694 Bacteria 1131
73 Ga0466968_0023119 3300044735 Bacteria 2530
74 Ga0466958_0945856 3300045836 Unclassified 562
75 Ga0466967_1105369 3300045976 Bacteria 790
76 Ga0466967_1406398 3300045976 Unclassified 695
77 Ga0495582_0459985 3300046473 Unclassified 735
78 Ga0495584_0600320 3300046491 Unclassified 561
79 Ga0495618_0554475 3300046514 Unclassified 688
80 Ga0495630_0619557 3300046517 Unclassified 829
81 Ga0495656_0013278 3300046615 Bacteria 3061
82 Ga0495613_0616616 3300046689 Bacteria 721
83 Ga0495670_0156039 3300046691 Bacteria 1198
84 Ga0495602_1133036 3300048088 Unclassified 512
85 Ga0496100_0010826 3300048903 Bacteria 5175
86 Ga0496100_0490720 3300048903 Bacteria 945
87 Ga0496101_0008499 3300048904 Bacteria 6709
88 Ga0496101_0029024 3300048904 Bacteria 3867
89 Ga0496102_1285558 3300048905 Bacteria 651
90 Ga0496106_0016770 3300048909 Bacteria 5420
91 Ga0496107_0004915 3300048910 Bacteria 9088
92 Ga0496107_0195169 3300048910 Bacteria 1504
93 Ga0496108_0790538 3300048911 Bacteria 819
94 Ga0496113_0441303 3300048916 Unclassified 1046
95 Ga0496114_0033635 3300048917 Bacteria 4225
96 Ga0501031_0007542 3300049568 Bacteria 7084
97 Ga0501031_0041409 3300049568 Bacteria 3007
98 Ga0501032_0122256 3300049569 Bacteria 1720
99 Ga0501033_0004405 3300049570 Bacteria 11272
100 Ga0501034_0199271 3300049571 Bacteria 1961
101 Ga0501036_0003432 3300049572 Bacteria 12660
102 Ga0501036_0174458 3300049572 Bacteria 1810
103 Ga0501036_1549586 3300049572 Bacteria 536
104 Ga0501037_0026302 3300049573 Bacteria 4300
105 Ga0501038_0027432 3300049574 Bacteria 5067
106 Ga0501038_0127655 3300049574 Bacteria 2091
107 Ga0501039_0026362 3300049575 Bacteria 4466
108 Ga0501039_0091514 3300049575 Bacteria 2370
109 Ga0501040_0005164 3300049576 Bacteria 8441
110 Ga0501041_0125153 3300049577 Bacteria 1599
111 Ga0501042_0149235 3300049578 Bacteria 1685
112 Ga0501043_0003363 3300049579 Bacteria 13173
113 Ga0501043_0024483 3300049579 Bacteria 4738
114 Ga0501046_0084248 3300049580 Bacteria 2452
115 Ga0501047_0341104 3300049581 Unclassified 1336
116 Ga0501048_0129075 3300049582 Bacteria 1787
117 Ga0501048_0389522 3300049582 Bacteria 995
118 Ga0501067_0142928 3300049583 Bacteria 1333
119 Ga0501068_0001372 3300049584 Bacteria 12938
120 Ga0501069_0029134 3300049585 Bacteria 3029
121 Ga0501069_0062852 3300049585 Bacteria 2073
122 Ga0501070_0084701 3300049586 Bacteria 2624
123 Ga0501071_0025301 3300049587 Bacteria 4157
124 Ga0501071_0274328 3300049587 Unclassified 1275
125 Ga0501072_0005849 3300049588 Bacteria 9372
126 Ga0501072_0821183 3300049588 Unclassified 727
127 Ga0501073_0028059 3300049589 Bacteria 4021
128 Ga0501073_0166954 3300049589 Bacteria 1524
129 Ga0501074_0090675 3300049590 Bacteria 2189
130 Ga0501075_0010341 3300049591 Bacteria 6557
131 Ga0501075_0041629 3300049591 Bacteria 3442
132 Ga0501076_0675437 3300049592 Bacteria 852
133 Ga0501077_0006288 3300049593 Bacteria 7267
134 Ga0501079_0092975 3300049741 Bacteria 2336
135 Ga0501080_0301371 3300049742 Bacteria 1453
136 Ga0501080_0505653 3300049742 Bacteria 1079
137 Ga0501081_0011623 3300049743 Bacteria 5761
138 Ga0501083_0032347 3300049744 Bacteria 3587
139 Ga0501083_0325135 3300049744 Bacteria 1000
140 Ga0501035_0159934 3300049822 Bacteria 1950
141 Ga0501044_0016299 3300049823 Bacteria 7984
142 Ga0501044_0697699 3300049823 Bacteria 901
143 Ga0501045_0055375 3300049824 Bacteria 2900
144 Ga0501045_1190332 3300049824 Bacteria 556
145 nmdc:mga08y16_462535_c1 3300050511 Unclassified 1293
146 nmdc:mga08y16_48413_c1 3300050511 Unclassified 4449
147 nmdc:mga08y16_847516_c1 3300050511 Bacteria 903
148 nmdc:mga0a205_656828_c1 3300050515 Unclassified 900
149 nmdc:mga0a205_68782_c1 3300050515 Bacteria 3419
150 Ga0501084_0037928 3300054114 Bacteria 4027
151 Ga0501082_0046788 3300060353 Bacteria 3728
152 8003832714 8003830390 Bacteria 6541657
153 Ga0307409_100698786
154 Ga0070683_100021459
155 Ga0070682_100385021
156 Ga0070668_100883692
157 Ga0070671_100211566
158 Ga0070663_100277363
159 Ga0068867_101306416
160 Ga0070699_100255452
161 Ga0070684_100124098
162 Ga0070672_101019260
163 Ga0070664_100696511
164 Ga0068861_100963374
165 Ga0068870_10353785
166 Ga0081455_10251974
167 Ga0081455_10394001
168 Ga0081538_10038090
169 Ga0081538_10218649
170 Ga0081540_1000700
171 Ga0081539_10166793
172 Ga0097621_101617342
173 Ga0075431_100058111
174 Ga0075433_11356133
175 Ga0075434_100051207
176 Ga0068865_101080990
177 Ga0111539_10107691
178 Ga0111539_10244201
179 Ga0105245_10392781
180 Ga0105243_10229434
181 Ga0157371_10553173
182 Ga0157380_10613333
183 Ga0182008_10060420
184 Ga0182008_10812354
185 Ga0182006_1215590
186 Ga0182007_10157683
187 Ga0207709_10229301
188 Ga0207661_10393105
189 Ga0207679_11094247
190 Ga0207668_11053721
191 Ga0207683_11410666
192 Ga0207428_10094518
193 Ga0207428_10440412
194 Ga0265327_10297946
195 Ga0307409_100792829
196 Ga0307409_101757853
197 Ga0307416_100996800
198 Ga0307415_100432995
199 Ga0395899_0016131
200 Ga0395899_0055844
201 Ga0395900_0051129
202 Ga0395900_0365579
203 Ga0395900_0431017
204 Ga0395900_0691557
205 Ga0395900_1064387
206 Ga0395898_0051561
207 Ga0395898_0260895
208 Ga0395898_0423605
209 Ga0395898_0530879
210 Ga0395905_0102748
211 Ga0395905_0148464
212 Ga0395905_1204658
213 Ga0395905_1468187
214 Ga0395901_0083322
215 Ga0395901_0257472
216 Ga0395901_0366198
217 Ga0395901_1298044
218 Ga0451789_0577841
219 Ga0451802_0292660
220 Ga0451804_0402529
221 Ga0451851_0608076
222 Ga0451853_2869338
223 Ga0466963_0182791
224 Ga0466963_0299549
225 Ga0466968_0023119
226 Ga0466958_0945856
227 Ga0466967_1105369
228 Ga0466967_1406398
229 Ga0495582_0459985
230 Ga0495584_0600320
231 Ga0495618_0554475
232 Ga0495630_0619557
233 Ga0495656_0013278
234 Ga0495613_0616616
235 Ga0495670_0156039
236 Ga0495602_1133036
237 Ga0496100_0010826
238 Ga0496100_0490720
239 Ga0496101_0008499
240 Ga0496101_0029024
241 Ga0496102_1285558
242 Ga0496106_0016770
243 Ga0496107_0004915
244 Ga0496107_0195169
245 Ga0496108_0790538
246 Ga0496113_0441303
247 Ga0496114_0033635
248 Ga0501031_0007542
249 Ga0501031_0041409
250 Ga0501032_0122256
251 Ga0501033_0004405
252 Ga0501034_0199271
253 Ga0501036_0003432
254 Ga0501036_0174458
255 Ga0501036_1549586
256 Ga0501037_0026302
257 Ga0501038_0027432
258 Ga0501038_0127655
259 Ga0501039_0026362
260 Ga0501039_0091514
261 Ga0501040_0005164
262 Ga0501041_0125153
263 Ga0501042_0149235
264 Ga0501043_0003363
265 Ga0501043_0024483
266 Ga0501046_0084248
267 Ga0501047_0341104
268 Ga0501048_0129075
269 Ga0501048_0389522
270 Ga0501067_0142928
271 Ga0501068_0001372
272 Ga0501069_0029134
273 Ga0501069_0062852
274 Ga0501070_0084701
275 Ga0501071_0025301
276 Ga0501071_0274328
277 Ga0501072_0005849
278 Ga0501072_0821183
279 Ga0501073_0028059
280 Ga0501073_0166954
281 Ga0501074_0090675
282 Ga0501075_0010341
283 Ga0501075_0041629
284 Ga0501076_0675437
285 Ga0501077_0006288
286 Ga0501079_0092975
287 Ga0501080_0301371
288 Ga0501080_0505653
289 Ga0501081_0011623
290 Ga0501083_0032347
291 Ga0501083_0325135
292 Ga0501035_0159934
293 Ga0501044_0016299
294 Ga0501044_0697699
295 Ga0501045_0055375
296 Ga0501045_1190332
297 nmdc:mga08y16_462535_c1
298 nmdc:mga08y16_48413_c1
299 nmdc:mga08y16_847516_c1
300 nmdc:mga0a205_656828_c1
301 nmdc:mga0a205_68782_c1
302 Ga0501084_0037928
303 Ga0501082_0046788
304 8003832714

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

20

140

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.9273 1 122
3hnq-assembly1.cif.gz_A crystal structure of virulence protein stm3117 from salmonella typhimurium. northeast structural genomics consortium target id str274 0.918 1 123
3ey8-assembly1.cif.gz_A structure from the mobile metagenome of v. pseudocholerae. vpc_cass1 0.9098 1 123
3zw5-assembly1.cif.gz_A crystal structure of the human glyoxalase domain-containing protein 5 0.9096 1 122
3ey7-assembly1.cif.gz_B structure from the mobile metagenome of v. cholerae. integron cassette protein vch_cass1 0.9094 1 123
ID Description Score Start End Superfamily
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9073 3 122 3.10.180.10
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9002 3 122 3.10.180.10
2i7rB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8036 1 121 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8 1 121 3.10.180.10
2i7rB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7913 1 121 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7V9CYM9-F1-model_v4 VOC family protein 0.9661 1 123
AF-A0A1V2PQA5-F1-model_v4 VOC domain-containing protein 0.9633 1 123 GO:0047661
AF-A0A017HU23-F1-model_v4 Biphenyl-2,3-diol 1,2-dioxygenase III-related protein 0.9609 1 123 GO:0051213
AF-A0A537SRX5-F1-model_v4 VOC family virulence protein 0.9601 1 123
AF-A0A389MU21-F1-model_v4 VOC domain-containing protein 0.9598 1 122

Map