F214761

General Info

Members Datasets Scaffolds Average Seq Length
152 81 304 129

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10305107|Ga0316579_103051072
Length 127
Sequence MDYGYKRKVDYPFEEAQKKLREELPKEGFGVLTEIDIKATLKKKLNVEFDSYIILGTCNPPFAYRALQAEKDIGLLLPCNIIVYEDAGQTYISAIVPTVAMSMVENESLADIAAEVEAKLKKVIDCL

Samples

Sample ID Description Type Environment
1 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
13 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
14 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
17 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
18 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
23 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
24 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
35 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
36 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
37 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
38 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
39 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
40 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
41 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
42 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
43 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
46 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
47 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
48 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
49 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
50 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
51 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
52 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
53 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
54 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
55 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
56 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
57 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
58 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
59 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
60 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
61 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
70 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
71 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
72 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
73 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
74 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
75 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
76 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
77 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
78 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
79 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
80 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
81 2941499720 Ensifer sp. 4252 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 1.32
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 0.66
Rhizosphere 98.68
Stem 0
Stem Tuber 0
Unclassified 19.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316579_10305107 3300031691 Archaea 770
2 Ga0070658_11285539 3300005327 Bacteria 635
3 Ga0070683_100172530 3300005329 Bacteria 2053
4 Ga0070682_100308151 3300005337 Bacteria 1165
5 Ga0070674_100614892 3300005356 Unclassified 920
6 Ga0070681_10729836 3300005458 Bacteria 907
7 Ga0070684_100592183 3300005535 Bacteria 1031
8 Ga0068853_100958517 3300005539 Bacteria 823
9 Ga0070695_101344305 3300005545 Unclassified 591
10 Ga0068855_100505731 3300005563 Unclassified 1312
11 Ga0068854_100486069 3300005578 Bacteria 1037
12 Ga0105240_10064134 3300009093 Bacteria 4566
13 Ga0105245_10536002 3300009098 Unclassified 1191
14 Ga0105241_10169222 3300009174 Bacteria 1803
15 Ga0105237_10074657 3300009545 Bacteria 3383
16 Ga0105239_10345158 3300010375 Unclassified 1680
17 Ga0157373_10076714 3300013100 Bacteria 2358
18 Ga0157371_10093498 3300013102 Bacteria 2131
19 Ga0157370_11425841 3300013104 Unclassified 623
20 Ga0163162_11570813 3300013306 Bacteria 750
21 Ga0157372_10223377 3300013307 Bacteria 2183
22 Ga0157372_11203472 3300013307 Bacteria 875
23 Ga0157380_10878187 3300014326 Bacteria 921
24 Ga0157380_12428531 3300014326 Bacteria 589
25 Ga0209233_1021197 3300025261 Bacteria 1688
26 Ga0207642_10162795 3300025899 Unclassified 1200
27 Ga0207707_10827347 3300025912 Bacteria 770
28 Ga0207695_11352471 3300025913 Bacteria 593
29 Ga0207671_10120991 3300025914 Bacteria 2001
30 Ga0207667_10982966 3300025949 Bacteria 832
31 Ga0207703_10476207 3300026035 Bacteria 1169
32 Ga0207639_11138705 3300026041 Bacteria 732
33 Ga0207708_10682608 3300026075 Bacteria 877
34 Ga0207702_11899156 3300026078 Bacteria 587
35 Ga0207698_11498545 3300026142 Unclassified 690
36 Ga0265324_10295291 3300029957 Bacteria 551
37 Ga0265316_10089644 3300031344 Bacteria 2347
38 Ga0316575_10000715 3300031665 Bacteria 9941
39 Ga0316575_10414127 3300031665 Unclassified 579
40 Ga0316579_10017386 3300031691 Bacteria 3152
41 Ga0316579_10020598 3300031691 Bacteria 2929
42 Ga0316579_10280497 3300031691 Bacteria 805
43 Ga0316576_10019388 3300031727 Unclassified 4660
44 Ga0316576_10020581 3300031727 Bacteria 4547
45 Ga0316576_10046377 3300031727 Bacteria 3145
46 Ga0316576_10076981 3300031727 Bacteria 2469
47 Ga0316576_10218950 3300031727 Bacteria 1432
48 Ga0316576_10363714 3300031727 Unclassified 1075
49 Ga0316578_10010832 3300031728 Bacteria 4748
50 Ga0316578_10071768 3300031728 Bacteria 2050
51 Ga0316578_10074063 3300031728 Bacteria 2018
52 Ga0316578_10159154 3300031728 Bacteria 1361
53 Ga0316577_10001194 3300031733 Bacteria 12004
54 Ga0316577_10004878 3300031733 Bacteria 6983
55 Ga0316577_10045035 3300031733 Bacteria 2467
56 Ga0316577_10049776 3300031733 Bacteria 2338
57 Ga0316577_10131410 3300031733 Bacteria 1409
58 Ga0316577_10192059 3300031733 Bacteria 1154
59 Ga0316577_10537425 3300031733 Bacteria 665
60 Ga0316577_10904048 3300031733 Bacteria 500
61 Ga0316583_10003145 3300032133 Bacteria 5800
62 Ga0316583_10016827 3300032133 Bacteria 2630
63 Ga0316583_10045509 3300032133 Unclassified 1549
64 Ga0316583_10064460 3300032133 Bacteria 1283
65 Ga0316583_10161851 3300032133 Bacteria 779
66 Ga0316585_10006467 3300032137 Bacteria 3351
67 Ga0316585_10028192 3300032137 Unclassified 1756
68 Ga0316585_10032992 3300032137 Bacteria 1632
69 Ga0316580_10009321 3300032139 Bacteria 2949
70 Ga0316580_10015481 3300032139 Bacteria 2334
71 Ga0316593_10222674 3300032168 Bacteria 701
72 Ga0316596_1163330 3300033541 Bacteria 614
73 Ga0316574_0046823 3300035398 Bacteria 2683
74 Ga0316574_0051308 3300035398 Bacteria 2570
75 Ga0316574_0052332 3300035398 Bacteria 2546
76 Ga0316574_0198391 3300035398 Bacteria 1289
77 Ga0373927_0497120 3300035695 Bacteria 806
78 Ga0316582_0066978 3300036647 Bacteria 2316
79 Ga0316582_0071479 3300036647 Bacteria 2247
80 Ga0316582_0114331 3300036647 Bacteria 1800
81 Ga0316582_0130155 3300036647 Bacteria 1690
82 Ga0316582_0211698 3300036647 Bacteria 1324
83 Ga0316582_0248060 3300036647 Bacteria 1220
84 Ga0316582_0307341 3300036647 Unclassified 1090
85 Ga0316582_0368740 3300036647 Bacteria 988
86 Ga0316582_0412341 3300036647 Bacteria 931
87 Ga0316582_0976518 3300036647 Bacteria 578
88 Ga0316584_0006871 3300036712 Bacteria 7733
89 Ga0316584_0011641 3300036712 Bacteria 6187
90 Ga0316584_0023262 3300036712 Bacteria 4527
91 Ga0316584_0137499 3300036712 Bacteria 1823
92 Ga0316584_0253332 3300036712 Bacteria 1285
93 Ga0316584_0297472 3300036712 Bacteria 1169
94 Ga0316584_0430642 3300036712 Unclassified 936
95 Ga0316584_0508405 3300036712 Bacteria 846
96 Ga0316581_0025320 3300037588 Bacteria 1765
97 Ga0316581_0145825 3300037588 Bacteria 730
98 Ga0451577_0000062 3300042876 Bacteria 267945
99 Ga0451577_0001582 3300042876 Bacteria 29709
100 Ga0451577_0047437 3300042876 Bacteria 3841
101 Ga0451577_0267327 3300042876 Unclassified 1549
102 Ga0451577_0548037 3300042876 Bacteria 1050
103 Ga0453683_0013530 3300044673 Bacteria 5323
104 Ga0453683_0243758 3300044673 Bacteria 1145
105 Ga0453684_0000334 3300044712 Bacteria 196444
106 Ga0453684_0000361 3300044712 Bacteria 188097
107 Ga0453684_0000442 3300044712 Bacteria 168993
108 Ga0453684_0001102 3300044712 Bacteria 84864
109 Ga0453684_0005530 3300044712 Bacteria 24938
110 Ga0453684_0013368 3300044712 Bacteria 13346
111 Ga0453684_0031064 3300044712 Bacteria 7522
112 Ga0453684_0064982 3300044712 Bacteria 4656
113 Ga0453684_0184720 3300044712 Bacteria 2445
114 Ga0453684_0189539 3300044712 Bacteria 2407
115 Ga0453684_0314015 3300044712 Bacteria 1777
116 Ga0453684_0522951 3300044712 Bacteria 1310
117 Ga0453684_0655182 3300044712 Bacteria 1145
118 Ga0453684_0731023 3300044712 Bacteria 1073
119 Ga0453684_0762717 3300044712 Bacteria 1046
120 Ga0453684_0837135 3300044712 Unclassified 990
121 Ga0451576_0001562 3300045051 Bacteria 38551
122 Ga0451576_0002325 3300045051 Bacteria 28786
123 Ga0451576_0070104 3300045051 Bacteria 3648
124 Ga0451576_0095315 3300045051 Bacteria 3095
125 Ga0495629_0092475 3300046459 Bacteria 2111
126 Ga0495582_0073030 3300046473 Bacteria 1899
127 Ga0495594_0138836 3300046499 Bacteria 1378
128 Ga0495588_0565605 3300046674 Bacteria 596
129 Ga0495581_0066768 3300047315 Bacteria 2080
130 Ga0495614_0176771 3300048089 Bacteria 959
131 Ga0496101_0749108 3300048904 Unclassified 771
132 Ga0501036_0718234 3300049572 Unclassified 825
133 Ga0501038_0773884 3300049574 Unclassified 715
134 Ga0501039_0303643 3300049575 Unclassified 1255
135 Ga0501040_0348681 3300049576 Unclassified 1060
136 Ga0501041_0815981 3300049577 Unclassified 598
137 Ga0501042_0051045 3300049578 Bacteria 2951
138 Ga0501046_0132484 3300049580 Bacteria 1890
139 Ga0501048_0495124 3300049582 Unclassified 876
140 Ga0501070_0466706 3300049586 Unclassified 1017
141 Ga0501071_0642330 3300049587 Bacteria 816
142 Ga0501072_1096399 3300049588 Unclassified 619
143 Ga0501075_0102744 3300049591 Bacteria 2171
144 Ga0501076_1335188 3300049592 Bacteria 589
145 Ga0501077_0194342 3300049593 Unclassified 1289
146 Ga0501079_0060648 3300049741 Bacteria 2918
147 Ga0501081_0253040 3300049743 Unclassified 1286
148 Ga0501083_0337624 3300049744 Bacteria 980
149 Ga0501084_0107430 3300054114 Bacteria 2344
150 Ga0501082_0070916 3300060353 Bacteria 3000
151 Ga0530510_0491150 3300061734 Unclassified 930
152 2941506514 2941499720 Bacteria 7599444
153 Ga0316579_10305107
154 Ga0070658_11285539
155 Ga0070683_100172530
156 Ga0070682_100308151
157 Ga0070674_100614892
158 Ga0070681_10729836
159 Ga0070684_100592183
160 Ga0068853_100958517
161 Ga0070695_101344305
162 Ga0068855_100505731
163 Ga0068854_100486069
164 Ga0105240_10064134
165 Ga0105245_10536002
166 Ga0105241_10169222
167 Ga0105237_10074657
168 Ga0105239_10345158
169 Ga0157373_10076714
170 Ga0157371_10093498
171 Ga0157370_11425841
172 Ga0163162_11570813
173 Ga0157372_10223377
174 Ga0157372_11203472
175 Ga0157380_10878187
176 Ga0157380_12428531
177 Ga0209233_1021197
178 Ga0207642_10162795
179 Ga0207707_10827347
180 Ga0207695_11352471
181 Ga0207671_10120991
182 Ga0207667_10982966
183 Ga0207703_10476207
184 Ga0207639_11138705
185 Ga0207708_10682608
186 Ga0207702_11899156
187 Ga0207698_11498545
188 Ga0265324_10295291
189 Ga0265316_10089644
190 Ga0316575_10000715
191 Ga0316575_10414127
192 Ga0316579_10017386
193 Ga0316579_10020598
194 Ga0316579_10280497
195 Ga0316576_10019388
196 Ga0316576_10020581
197 Ga0316576_10046377
198 Ga0316576_10076981
199 Ga0316576_10218950
200 Ga0316576_10363714
201 Ga0316578_10010832
202 Ga0316578_10071768
203 Ga0316578_10074063
204 Ga0316578_10159154
205 Ga0316577_10001194
206 Ga0316577_10004878
207 Ga0316577_10045035
208 Ga0316577_10049776
209 Ga0316577_10131410
210 Ga0316577_10192059
211 Ga0316577_10537425
212 Ga0316577_10904048
213 Ga0316583_10003145
214 Ga0316583_10016827
215 Ga0316583_10045509
216 Ga0316583_10064460
217 Ga0316583_10161851
218 Ga0316585_10006467
219 Ga0316585_10028192
220 Ga0316585_10032992
221 Ga0316580_10009321
222 Ga0316580_10015481
223 Ga0316593_10222674
224 Ga0316596_1163330
225 Ga0316574_0046823
226 Ga0316574_0051308
227 Ga0316574_0052332
228 Ga0316574_0198391
229 Ga0373927_0497120
230 Ga0316582_0066978
231 Ga0316582_0071479
232 Ga0316582_0114331
233 Ga0316582_0130155
234 Ga0316582_0211698
235 Ga0316582_0248060
236 Ga0316582_0307341
237 Ga0316582_0368740
238 Ga0316582_0412341
239 Ga0316582_0976518
240 Ga0316584_0006871
241 Ga0316584_0011641
242 Ga0316584_0023262
243 Ga0316584_0137499
244 Ga0316584_0253332
245 Ga0316584_0297472
246 Ga0316584_0430642
247 Ga0316584_0508405
248 Ga0316581_0025320
249 Ga0316581_0145825
250 Ga0451577_0000062
251 Ga0451577_0001582
252 Ga0451577_0047437
253 Ga0451577_0267327
254 Ga0451577_0548037
255 Ga0453683_0013530
256 Ga0453683_0243758
257 Ga0453684_0000334
258 Ga0453684_0000361
259 Ga0453684_0000442
260 Ga0453684_0001102
261 Ga0453684_0005530
262 Ga0453684_0013368
263 Ga0453684_0031064
264 Ga0453684_0064982
265 Ga0453684_0184720
266 Ga0453684_0189539
267 Ga0453684_0314015
268 Ga0453684_0522951
269 Ga0453684_0655182
270 Ga0453684_0731023
271 Ga0453684_0762717
272 Ga0453684_0837135
273 Ga0451576_0001562
274 Ga0451576_0002325
275 Ga0451576_0070104
276 Ga0451576_0095315
277 Ga0495629_0092475
278 Ga0495582_0073030
279 Ga0495594_0138836
280 Ga0495588_0565605
281 Ga0495581_0066768
282 Ga0495614_0176771
283 Ga0496101_0749108
284 Ga0501036_0718234
285 Ga0501038_0773884
286 Ga0501039_0303643
287 Ga0501040_0348681
288 Ga0501041_0815981
289 Ga0501042_0051045
290 Ga0501046_0132484
291 Ga0501048_0495124
292 Ga0501070_0466706
293 Ga0501071_0642330
294 Ga0501072_1096399
295 Ga0501075_0102744
296 Ga0501076_1335188
297 Ga0501077_0194342
298 Ga0501079_0060648
299 Ga0501081_0253040
300 Ga0501083_0337624
301 Ga0501084_0107430
302 Ga0501082_0070916
303 Ga0530510_0491150
304 2941506514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03625

DUF302

Domain of unknown function DUF302

35

97

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j3m-assembly1.cif.gz_B crystal structure of the conserved hypothetical protein tt1751 from thermus thermophilus hb8 0.9453 6 128
1q9u-assembly1.cif.gz_B crystal structure of uncharacterized conserved protein duf302 from bacillus stearothermophilus 0.9177 1 126
1j3m-assembly1.cif.gz_B crystal structure of the conserved hypothetical protein tt1751 from thermus thermophilus hb8 0.9094 6 128
7tj1-assembly1.cif.gz_C crystal structure of the putative fluoride ion transporter crcb bab1_1389 from brucella abortus 0.8663 1 126
7tj1-assembly1.cif.gz_C crystal structure of the putative fluoride ion transporter crcb bab1_1389 from brucella abortus 0.8481 1 126
ID Description Score Start End Superfamily
1j3mB00 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TT1751-like domain 0.9453 6 128 3.30.310.70
1q9uB00 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TT1751-like domain 0.9164 1 126 3.30.310.70
1j3mB00 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TT1751-like domain 0.9094 6 128 3.30.310.70
1q9uB00 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TT1751-like domain 0.8892 1 126 3.30.310.70
af_P9WIF1_251_555_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.6924 79 95 2.40.70.10
ID Description Score Start End GO Terms
AF-A0A3M1H4W6-F1-model_v4 DUF302 domain-containing protein 0.984 5 126
AF-A0A1K2IST0-F1-model_v4 Uncharacterized conserved protein, DUF302 family 0.9838 1 128
AF-A0A2W7QM61-F1-model_v4 Uncharacterized protein (DUF302 family) 0.9837 1 128
AF-A0A257KGA7-F1-model_v4 DUF302 domain-containing protein 0.9816 1 126
AF-A0A1W7QQQ9-F1-model_v4 deleted 0.9807 3 128

Map