F214727

General Info

Members Datasets Scaffolds Average Seq Length
152 107 304 157

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10002195|Ga0265327_100021955
Length 152
Sequence MLHTLQTTQILKTDLDSLWDFMSSPLNLAKITPSYMGFNIITGLEENKIHAGQIIEYHIKPIAGIKMHWVTEITHVKDKEYFVDEQRFGPYAFWHHKHILKTVPEGVEMTDVLHYKVPFGFLGKIADAFFIKKKIKEIFDFRYRKLEELFNN

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
47 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
48 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
73 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
74 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
75 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
76 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
77 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
78 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
79 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
82 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
83 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
84 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
85 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
86 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
87 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
88 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
89 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
90 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
91 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
92 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
93 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
94 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
95 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
96 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
97 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
98 2738541302 Pedobacter sp. CF074 Isolate Unclassified
99 2739367651 Pedobacter sp. OK291 Isolate Unclassified
100 2818991437 Pedobacter terrae 518 Isolate Unclassified
101 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
102 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
103 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
104 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
105 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
106 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
107 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.42
Metatranscriptomes 0
Isolates 6.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.47
Nodule 0
Rhizoplane 0
Rhizosphere 78.29
Stem 0
Stem Tuber 0
Unclassified 14.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10002195 3300031251 Bacteria 21429
2 JGI25162J39368_1000435 3300002737 Bacteria 33619
3 JGI25157J39369_1020142 3300002741 Unclassified 798
4 JGI25164J39214_1002757 3300002772 Unclassified 2499
5 JGI25152J39213_1000292 3300002773 Bacteria 32967
6 JGI25150J39212_1000014 3300002774 Bacteria 170955
7 JGI25151J46595_10000042 3300003187 Bacteria 170955
8 JGI25165J46597_1002884 3300003214 Bacteria 4886
9 JGI25153J46596_10000009 3300003215 Bacteria 340925
10 rootH2_10222591 3300003320 Unclassified 2561
11 rootH1_10003362 3300003323 Bacteria 34489
12 Ga0065714_10133848 3300005288 Bacteria 1226
13 Ga0065712_10279095 3300005290 Unclassified 899
14 Ga0070683_100673675 3300005329 Unclassified 990
15 Ga0070670_100645698 3300005331 Bacteria 949
16 Ga0070660_100012322 3300005339 Bacteria 6104
17 Ga0070687_100036131 3300005343 Bacteria 2459
18 Ga0070669_100493656 3300005353 Bacteria 1015
19 Ga0070671_100356541 3300005355 Unclassified 1249
20 Ga0070684_100078265 3300005535 Bacteria 2921
21 Ga0070672_101022200 3300005543 Bacteria 733
22 Ga0068856_100000023 3300005614 Bacteria 141671
23 Ga0068856_100389573 3300005614 Unclassified 1413
24 Ga0068852_100620154 3300005616 Bacteria 1087
25 Ga0068861_100027631 3300005719 Unclassified 4135
26 Ga0105240_10051100 3300009093 Bacteria 5205
27 Ga0105240_10095139 3300009093 Unclassified 3632
28 Ga0105240_10110932 3300009093 Bacteria 3319
29 Ga0105240_10217706 3300009093 Bacteria 2226
30 Ga0105241_10070131 3300009174 Bacteria 2719
31 Ga0105241_10092347 3300009174 Bacteria 2390
32 Ga0105241_10742310 3300009174 Bacteria 899
33 Ga0105241_11106156 3300009174 Unclassified 746
34 Ga0105237_10054806 3300009545 Bacteria 3994
35 Ga0105237_10063169 3300009545 Bacteria 3701
36 Ga0105237_10065965 3300009545 Unclassified 3615
37 Ga0105238_10250233 3300009551 Bacteria 1750
38 Ga0105239_10000007 3300010375 Bacteria 385297
39 Ga0105239_10000008 3300010375 Bacteria 376925
40 Ga0105239_10010943 3300010375 Bacteria 10133
41 Ga0105239_10061575 3300010375 Bacteria 4119
42 Ga0157373_10000129 3300013100 Bacteria 59252
43 Ga0157373_10002056 3300013100 Bacteria 15248
44 Ga0157371_10000434 3300013102 Bacteria 51244
45 Ga0157371_10004094 3300013102 Bacteria 12889
46 Ga0157370_10073427 3300013104 Bacteria 3227
47 Ga0157370_10161611 3300013104 Bacteria 2084
48 Ga0157370_10885048 3300013104 Bacteria 811
49 Ga0157370_10900747 3300013104 Bacteria 803
50 Ga0157369_10000897 3300013105 Bacteria 37997
51 Ga0157369_11457879 3300013105 Unclassified 696
52 Ga0157374_10011598 3300013296 Bacteria 7640
53 Ga0157374_10282854 3300013296 Unclassified 1638
54 Ga0157378_10740790 3300013297 Unclassified 1005
55 Ga0163162_10005458 3300013306 Bacteria 12284
56 Ga0163162_10021354 3300013306 Bacteria 6375
57 Ga0163162_10265280 3300013306 Bacteria 1849
58 Ga0157372_10013468 3300013307 Bacteria 8739
59 Ga0157372_10222875 3300013307 Unclassified 2186
60 Ga0157372_11505037 3300013307 Bacteria 775
61 Ga0182006_1000424 3300015261 Bacteria 33825
62 Ga0182007_10000002 3300015262 Bacteria 564661
63 Ga0183373_1004 3300015682 Bacteria 537398
64 Ga0163161_10028373 3300017792 Bacteria 3975
65 Ga0163161_10226395 3300017792 Bacteria 1450
66 Ga0163161_10631465 3300017792 Unclassified 886
67 Ga0209563_106923 3300025230 Unclassified 1905
68 Ga0207427_100644 3300025231 Bacteria 16924
69 Ga0209437_100112 3300025233 Bacteria 214292
70 Ga0207425_1000023 3300025245 Bacteria 341339
71 Ga0209129_1000032 3300025258 Bacteria 341150
72 Ga0209233_1000126 3300025261 Bacteria 214298
73 Ga0209025_1000047 3300025294 Bacteria 341150
74 Ga0209758_1000145 3300025297 Bacteria 170553
75 Ga0207695_10038577 3300025913 Bacteria 5140
76 Ga0207671_10001334 3300025914 Bacteria 28837
77 Ga0207671_10007440 3300025914 Bacteria 9501
78 Ga0207662_10176973 3300025918 Bacteria 1371
79 Ga0207657_10007830 3300025919 Bacteria 10903
80 Ga0207657_10139034 3300025919 Bacteria 1985
81 Ga0207652_10163274 3300025921 Bacteria 1997
82 Ga0207650_10757937 3300025925 Bacteria 822
83 Ga0207702_10000258 3300026078 Bacteria 61221
84 Ga0207702_11311790 3300026078 Bacteria 718
85 Ga0207675_100003678 3300026118 Bacteria 14949
86 Ga0207698_10949797 3300026142 Bacteria 869
87 Ga0307509_10287412 3300031507 Bacteria 1401
88 Ga0307405_10000015 3300031731 Bacteria 206299
89 Ga0395899_0007683 3300037312 Bacteria 8312
90 Ga0395900_0003370 3300037418 Bacteria 17259
91 Ga0395898_0177355 3300037466 Bacteria 2036
92 Ga0395905_0001592 3300037471 Bacteria 27004
93 Ga0395901_0002487 3300038443 Bacteria 18676
94 Ga0451837_0406308 3300041494 Bacteria 842
95 Ga0451577_0830577 3300042876 Bacteria 834
96 Ga0453683_0021720 3300044673 Unclassified 4095
97 Ga0453683_0953273 3300044673 Unclassified 568
98 Ga0453684_0078239 3300044712 Unclassified 4139
99 Ga0453684_0257131 3300044712 Bacteria 2002
100 Ga0453684_0330025 3300044712 Unclassified 1725
101 Ga0453684_0331365 3300044712 Bacteria 1721
102 Ga0453684_0933164 3300044712 Bacteria 927
103 Ga0451576_0045725 3300045051 Bacteria 4609
104 Ga0495638_0413433 3300046460 Bacteria 697
105 Ga0495651_0749517 3300046462 Unclassified 606
106 Ga0495650_0000231 3300046471 Bacteria 113969
107 Ga0495585_0000037 3300046492 Bacteria 133335
108 Ga0495607_0293190 3300046501 Bacteria 768
109 Ga0495606_0000060 3300046507 Bacteria 185907
110 Ga0495606_0015896 3300046507 Bacteria 5774
111 Ga0495606_0048673 3300046507 Bacteria 2786
112 Ga0495606_0055270 3300046507 Bacteria 2568
113 Ga0495606_0070500 3300046507 Bacteria 2204
114 Ga0495610_0005229 3300046512 Bacteria 9287
115 Ga0495610_0069085 3300046512 Bacteria 1654
116 Ga0495616_0001826 3300046513 Bacteria 14422
117 Ga0495616_0003071 3300046513 Bacteria 10816
118 Ga0495609_0003523 3300046538 Bacteria 8921
119 Ga0495609_0027827 3300046538 Bacteria 2582
120 Ga0495625_0000191 3300046660 Bacteria 97363
121 Ga0495625_0154044 3300046660 Bacteria 1543
122 Ga0495661_0000696 3300046665 Bacteria 33446
123 Ga0495661_0005895 3300046665 Bacteria 8658
124 Ga0495649_0000061 3300046694 Bacteria 97338
125 Ga0495589_0075266 3300046794 Bacteria 1646
126 Ga0495660_0073611 3300046810 Bacteria 1806
127 Ga0495687_010749 3300047443 Bacteria 4989
128 Ga0495679_022042 3300047446 Bacteria 2187
129 Ga0495673_0022884 3300047469 Bacteria 3054
130 Ga0495681_0134835 3300047470 Bacteria 1048
131 Ga0495686_0046671 3300047472 Bacteria 2737
132 Ga0495686_0048429 3300047472 Bacteria 2679
133 Ga0495686_0287100 3300047472 Bacteria 913
134 Ga0495614_0038545 3300048089 Bacteria 2051
135 Ga0495678_015892 3300049459 Bacteria 3454
136 nmdc:mga0k408_378_c2 3300050493 Bacteria 19990
137 Ga0500635_0001245 3300053080 Bacteria 6080
138 Ga0500650_0341925 3300053098 Bacteria 656
139 Ga0500608_017745 3300053122 Bacteria 3238
140 Ga0500618_000005 3300053125 Bacteria 253092
141 Ga0500618_106902 3300053125 Bacteria 631
142 Ga0500622_0118296 3300053156 Bacteria 1288
143 2738856120 2738541302 Bacteria 5944758
144 2739588309 2739367651 Bacteria 6359826
145 2819546291 2818991437 Bacteria 5805520
146 2842723871 2842722452 Bacteria 6263924
147 2842912398 2842909656 Bacteria 6185908
148 2852625794 2852623160 Bacteria 4376875
149 2884935680 2884933994 Bacteria 4535041
150 2928152707 2928147474 Bacteria 6512076
151 2945999373 2945997725 Bacteria 6404843
152 2954021781 2954016120 Bacteria 6446024
153 Ga0265327_10002195
154 JGI25162J39368_1000435
155 JGI25157J39369_1020142
156 JGI25164J39214_1002757
157 JGI25152J39213_1000292
158 JGI25150J39212_1000014
159 JGI25151J46595_10000042
160 JGI25165J46597_1002884
161 JGI25153J46596_10000009
162 rootH2_10222591
163 rootH1_10003362
164 Ga0065714_10133848
165 Ga0065712_10279095
166 Ga0070683_100673675
167 Ga0070670_100645698
168 Ga0070660_100012322
169 Ga0070687_100036131
170 Ga0070669_100493656
171 Ga0070671_100356541
172 Ga0070684_100078265
173 Ga0070672_101022200
174 Ga0068856_100000023
175 Ga0068856_100389573
176 Ga0068852_100620154
177 Ga0068861_100027631
178 Ga0105240_10051100
179 Ga0105240_10095139
180 Ga0105240_10110932
181 Ga0105240_10217706
182 Ga0105241_10070131
183 Ga0105241_10092347
184 Ga0105241_10742310
185 Ga0105241_11106156
186 Ga0105237_10054806
187 Ga0105237_10063169
188 Ga0105237_10065965
189 Ga0105238_10250233
190 Ga0105239_10000007
191 Ga0105239_10000008
192 Ga0105239_10010943
193 Ga0105239_10061575
194 Ga0157373_10000129
195 Ga0157373_10002056
196 Ga0157371_10000434
197 Ga0157371_10004094
198 Ga0157370_10073427
199 Ga0157370_10161611
200 Ga0157370_10885048
201 Ga0157370_10900747
202 Ga0157369_10000897
203 Ga0157369_11457879
204 Ga0157374_10011598
205 Ga0157374_10282854
206 Ga0157378_10740790
207 Ga0163162_10005458
208 Ga0163162_10021354
209 Ga0163162_10265280
210 Ga0157372_10013468
211 Ga0157372_10222875
212 Ga0157372_11505037
213 Ga0182006_1000424
214 Ga0182007_10000002
215 Ga0183373_1004
216 Ga0163161_10028373
217 Ga0163161_10226395
218 Ga0163161_10631465
219 Ga0209563_106923
220 Ga0207427_100644
221 Ga0209437_100112
222 Ga0207425_1000023
223 Ga0209129_1000032
224 Ga0209233_1000126
225 Ga0209025_1000047
226 Ga0209758_1000145
227 Ga0207695_10038577
228 Ga0207671_10001334
229 Ga0207671_10007440
230 Ga0207662_10176973
231 Ga0207657_10007830
232 Ga0207657_10139034
233 Ga0207652_10163274
234 Ga0207650_10757937
235 Ga0207702_10000258
236 Ga0207702_11311790
237 Ga0207675_100003678
238 Ga0207698_10949797
239 Ga0307509_10287412
240 Ga0307405_10000015
241 Ga0395899_0007683
242 Ga0395900_0003370
243 Ga0395898_0177355
244 Ga0395905_0001592
245 Ga0395901_0002487
246 Ga0451837_0406308
247 Ga0451577_0830577
248 Ga0453683_0021720
249 Ga0453683_0953273
250 Ga0453684_0078239
251 Ga0453684_0257131
252 Ga0453684_0330025
253 Ga0453684_0331365
254 Ga0453684_0933164
255 Ga0451576_0045725
256 Ga0495638_0413433
257 Ga0495651_0749517
258 Ga0495650_0000231
259 Ga0495585_0000037
260 Ga0495607_0293190
261 Ga0495606_0000060
262 Ga0495606_0015896
263 Ga0495606_0048673
264 Ga0495606_0055270
265 Ga0495606_0070500
266 Ga0495610_0005229
267 Ga0495610_0069085
268 Ga0495616_0001826
269 Ga0495616_0003071
270 Ga0495609_0003523
271 Ga0495609_0027827
272 Ga0495625_0000191
273 Ga0495625_0154044
274 Ga0495661_0000696
275 Ga0495661_0005895
276 Ga0495649_0000061
277 Ga0495589_0075266
278 Ga0495660_0073611
279 Ga0495687_010749
280 Ga0495679_022042
281 Ga0495673_0022884
282 Ga0495681_0134835
283 Ga0495686_0046671
284 Ga0495686_0048429
285 Ga0495686_0287100
286 Ga0495614_0038545
287 Ga0495678_015892
288 nmdc:mga0k408_378_c2
289 Ga0500635_0001245
290 Ga0500650_0341925
291 Ga0500608_017745
292 Ga0500618_000005
293 Ga0500618_106902
294 Ga0500622_0118296
295 2738856120
296 2739588309
297 2819546291
298 2842723871
299 2842912398
300 2852625794
301 2884935680
302 2928152707
303 2945999373
304 2954021781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tl1-assembly2.cif.gz_B crystal structure of the streptomyces coelicolor whie orfvi polyketide aromatase/cyclase 0.8148 5 153
2res-assembly1.cif.gz_A tetracenomycin aro/cyc mutant r69a 0.8097 2 151
5wox-assembly1.cif.gz_A nmr solution structure of kany protein (ms6282) using two 4d-spectra 0.7981 1 151
7tmu-assembly4.cif.gz_D crystal structure of the protein of unknown function ypo0625 from yersinia pestis 0.7905 3 150
5wox-assembly1.cif.gz_A nmr solution structure of kany protein (ms6282) using two 4d-spectra 0.7786 1 151
ID Description Score Start End Superfamily
2resA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8097 2 151 3.30.530.20
af_P9WJ05_1_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8011 4 152 3.30.530.20
af_I1JXW9_329_493_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7994 3 151 3.30.530.20
af_O06816_9_161_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7988 6 152 3.30.530.20
af_I6XI16_7_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7932 8 152 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A517SGL5-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.909 2 151
AF-A0A2E6YJ87-F1-model_v4 CDP-paratose 2-epimerase 0.9089 1 153
AF-A0A1G0RVV5-F1-model_v4 Coenzyme Q-binding protein COQ10 START domain-containing protein 0.9082 1 160
AF-A0A562RRJ3-F1-model_v4 Ligand-binding SRPBCC domain-containing protein 0.9071 1 152
AF-A0A521D6W4-F1-model_v4 Ligand-binding SRPBCC domain-containing protein 0.9049 1 158

Map