F214720

General Info

Members Datasets Scaffolds Average Seq Length
152 105 152 161

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10016786|Ga0265325_100167863
Length 185
Sequence MATAERILTDEMIEAIKAYFPRYPTRQAVTLPALHIVNERLRYVPIAAVVEIAELLGLAPAEVQDTLSFYGFFKQDAPHGRTRAWVCRSISCALRGGEEVLDHLCHNLGIRPGETTPDGRVTLEFAECLGACDFAPCMLAGDTLHKDLTAEKADAWLAELRSIDNDTDDARQSSAPELAKGREQP

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
52 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
53 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
54 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
57 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
58 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
59 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
62 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
65 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
66 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
69 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
73 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
74 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
75 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
76 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
77 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
78 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
79 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
80 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
81 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
82 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
83 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
84 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
85 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
97 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
103 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
104 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
105 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 5.26
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 6.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_1715966 2162886011 Bacteria 1891
2 Ga0065704_10091856 3300005289 Bacteria 2690
3 Ga0065712_10068598 3300005290 Bacteria 9708
4 Ga0065707_10086907 3300005295 Bacteria 5249
5 Ga0070683_101209378 3300005329 Bacteria 726
6 Ga0070689_100141242 3300005340 Unclassified 1937
7 Ga0070714_100229601 3300005435 Bacteria 1709
8 Ga0070713_101277868 3300005436 Unclassified 711
9 Ga0068867_101029831 3300005459 Unclassified 748
10 Ga0070706_100235847 3300005467 Bacteria 1708
11 Ga0070679_100876332 3300005530 Unclassified 841
12 Ga0070684_101734543 3300005535 Bacteria 589
13 Ga0070684_101924730 3300005535 Bacteria 558
14 Ga0070697_100661346 3300005536 Bacteria 920
15 Ga0070686_100087411 3300005544 Bacteria 2078
16 Ga0070665_100000598 3300005548 Bacteria 50082
17 Ga0068857_100341096 3300005577 Bacteria 1386
18 Ga0068854_101126642 3300005578 Bacteria 700
19 Ga0068863_100985930 3300005841 Bacteria 845
20 Ga0068858_100178583 3300005842 Bacteria 2004
21 Ga0068860_100267035 3300005843 Bacteria 1669
22 Ga0068860_100325439 3300005843 Bacteria 1509
23 Ga0081455_10036281 3300005937 Bacteria 4392
24 Ga0081455_10611493 3300005937 Unclassified 708
25 Ga0070717_10031016 3300006028 Bacteria 4298
26 Ga0070717_10556417 3300006028 Bacteria 1039
27 Ga0070715_10408964 3300006163 Bacteria 756
28 Ga0075428_100011802 3300006844 Bacteria 9722
29 Ga0075428_100030825 3300006844 Bacteria 5929
30 Ga0075428_100046276 3300006844 Bacteria 4779
31 Ga0075433_10184819 3300006852 Bacteria 1854
32 Ga0075434_100708365 3300006871 Bacteria 1024
33 Ga0105240_11845489 3300009093 Bacteria 629
34 Ga0111539_10345082 3300009094 Bacteria 1733
35 Ga0111539_11761101 3300009094 Bacteria 718
36 Ga0105245_10853911 3300009098 Unclassified 950
37 Ga0105247_10031510 3300009101 Bacteria 3218
38 Ga0114129_11601119 3300009147 Bacteria 797
39 Ga0105241_10492535 3300009174 Bacteria 1091
40 Ga0105242_10774537 3300009176 Bacteria 947
41 Ga0105239_10190747 3300010375 Bacteria 2294
42 Ga0105239_10793067 3300010375 Unclassified 1085
43 Ga0105246_10349121 3300011119 Bacteria 1212
44 Ga0163163_10327921 3300014325 Bacteria 1585
45 Ga0163163_12386836 3300014325 Bacteria 587
46 Ga0207710_10090199 3300025900 Bacteria 1433
47 Ga0207684_11166396 3300025910 Bacteria 639
48 Ga0207652_10754603 3300025921 Unclassified 866
49 Ga0207664_10257999 3300025929 Bacteria 1523
50 Ga0207670_10087144 3300025936 Bacteria 2199
51 Ga0207670_10543566 3300025936 Unclassified 948
52 Ga0207670_11423036 3300025936 Unclassified 589
53 Ga0207712_10330230 3300025961 Bacteria 1261
54 Ga0207712_11043357 3300025961 Bacteria 726
55 Ga0207648_10901669 3300026089 Unclassified 826
56 Ga0207683_10953732 3300026121 Unclassified 797
57 Ga0268266_10000835 3300028379 Bacteria 40250
58 Ga0268265_10373718 3300028380 Unclassified 1309
59 Ga0268264_10105900 3300028381 Bacteria 2454
60 Ga0268264_10552030 3300028381 Bacteria 1130
61 Ga0268264_10920249 3300028381 Bacteria 878
62 Ga0265318_10127153 3300028577 Unclassified 937
63 Ga0265338_10001664 3300028800 Bacteria 35394
64 Ga0265332_10023067 3300031238 Bacteria 2745
65 Ga0265325_10001093 3300031241 Bacteria 19490
66 Ga0265325_10016786 3300031241 Bacteria 4086
67 Ga0265339_10000368 3300031249 Bacteria 35412
68 Ga0265331_10012364 3300031250 Bacteria 4625
69 Ga0265313_10000050 3300031595 Bacteria 111425
70 Ga0265314_10000306 3300031711 Bacteria 70032
71 Ga0265342_10003624 3300031712 Bacteria 12573
72 Ga0316574_0114446 3300035398 Bacteria 1730
73 Ga0373927_0590948 3300035695 Unclassified 734
74 Ga0373947_0620758 3300035725 Bacteria 737
75 Ga0373925_0640181 3300037068 Bacteria 876
76 Ga0436364_0220917 3300037853 Bacteria 1127
77 Ga0436364_0368215 3300037853 Archaea 972
78 Ga0436364_0655349 3300037853 Bacteria 531
79 Ga0436364_1071435 3300037853 Bacteria 971
80 Ga0237819_08651 3300038705 Bacteria 1400
81 Ga0436365_1025936 3300039437 Bacteria 1754
82 Ga0436365_1084136 3300039437 Bacteria 566
83 Ga0436365_1611034 3300039437 Unclassified 543
84 Ga0436360_0291162 3300039438 Bacteria 661
85 Ga0436360_0506319 3300039438 Bacteria 936
86 Ga0436360_0570968 3300039438 Viruses 611
87 Ga0436360_0681378 3300039438 Bacteria 894
88 Ga0436360_0743454 3300039438 Unclassified 885
89 Ga0436360_0782874 3300039438 Bacteria 648
90 Ga0436360_0839236 3300039438 Bacteria 892
91 Ga0436360_1015676 3300039438 Bacteria 686
92 Ga0436363_0201646 3300039450 Bacteria 619
93 Ga0436363_0271177 3300039450 Bacteria 721
94 Ga0436362_0530901 3300039453 Bacteria 654
95 Ga0466967_0807420 3300045976 Bacteria 932
96 Ga0495608_0032607 3300046511 Bacteria 3521
97 Ga0495618_0552047 3300046514 Bacteria 690
98 Ga0495630_0158848 3300046517 Bacteria 1721
99 Ga0495652_0231172 3300046529 Bacteria 1383
100 Ga0495586_0354386 3300046535 Unclassified 843
101 Ga0495667_0053715 3300046559 Bacteria 2653
102 Ga0495667_0330591 3300046559 Unclassified 964
103 Ga0495635_1020733 3300046663 Bacteria 526
104 Ga0495600_0776655 3300046809 Bacteria 572
105 Ga0495604_0118767 3300047317 Bacteria 1916
106 Ga0495604_0770034 3300047317 Unclassified 608
107 Ga0495675_0013046 3300047444 Bacteria 5241
108 Ga0495602_0239466 3300048088 Bacteria 1358
109 Ga0496105_0717358 3300048908 Bacteria 766
110 Ga0496108_0150606 3300048911 Bacteria 2007
111 Ga0496108_0996164 3300048911 Bacteria 716
112 Ga0496110_0996191 3300048913 Bacteria 745
113 Ga0496111_0463833 3300048914 Bacteria 934
114 Ga0496111_0503825 3300048914 Bacteria 891
115 Ga0496114_0247012 3300048917 Bacteria 1570
116 Ga0496115_0122308 3300048918 Bacteria 2142
117 Ga0501033_0062896 3300049570 Bacteria 2732
118 Ga0501034_0004966 3300049571 Bacteria 14639
119 Ga0501034_0008747 3300049571 Bacteria 10655
120 Ga0501034_0009671 3300049571 Bacteria 10085
121 Ga0501034_0145045 3300049571 Bacteria 2352
122 Ga0501034_0257991 3300049571 Bacteria 1686
123 Ga0501036_0059091 3300049572 Bacteria 3249
124 Ga0501039_0372441 3300049575 Bacteria 1122
125 Ga0501043_0011830 3300049579 Bacteria 6836
126 Ga0501046_0010198 3300049580 Bacteria 8085
127 Ga0501047_0039013 3300049581 Bacteria 4594
128 Ga0501047_0464323 3300049581 Bacteria 1094
129 Ga0501047_0502762 3300049581 Bacteria 1039
130 Ga0501047_0673430 3300049581 Bacteria 853
131 Ga0501047_0975528 3300049581 Unclassified 661
132 Ga0501048_0143508 3300049582 Bacteria 1688
133 Ga0501048_0509694 3300049582 Bacteria 863
134 Ga0501048_0697714 3300049582 Unclassified 729
135 Ga0501070_0000362 3300049586 Bacteria 41296
136 Ga0501071_0202882 3300049587 Bacteria 1490
137 Ga0501080_0586186 3300049742 Bacteria 991
138 Ga0501081_0780234 3300049743 Bacteria 719
139 Ga0501083_0049476 3300049744 Bacteria 2833
140 Ga0501044_0220788 3300049823 Bacteria 1846
141 Ga0501044_0280109 3300049823 Unclassified 1601
142 Ga0501044_0494659 3300049823 Bacteria 1125
143 nmdc:mga00v17_745320_c1 3300050491 Bacteria 626
144 nmdc:mga08y16_1666388_c1 3300050511 Unclassified 594
145 nmdc:mga08y16_1762162_c1 3300050511 Unclassified 573
146 nmdc:mga0n895_1025768_c1 3300050512 Bacteria 805
147 nmdc:mga0a205_498276_c1 3300050515 Bacteria 1075
148 Ga0495601_0000687 3300053077 Bacteria 18127
149 Ga0495601_0203398 3300053077 Bacteria 1294
150 Ga0501084_0010693 3300054114 Bacteria 7596
151 Ga0501084_0682696 3300054114 Bacteria 866
152 Ga0501082_1341958 3300060353 Bacteria 625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0996191 Ga0496110_0996191_20_430 133
2 3300046559 Ga0495667_0330591 Ga0495667_0330591_476_943 149
3 3300049581 Ga0501047_0502762 Ga0501047_0502762_156_629 149
4 3300005459 Ga0068867_101029831 Ga0068867_1010298312 150
5 3300005548 Ga0070665_100000598 Ga0070665_10000059839 150
6 3300026089 Ga0207648_10901669 Ga0207648_109016692 150
7 3300028379 Ga0268266_10000835 Ga0268266_100008354 150
8 3300047317 Ga0495604_0770034 Ga0495604_0770034_97_597 150
9 3300049581 Ga0501047_0673430 Ga0501047_0673430_16_483 150
10 3300049582 Ga0501048_0143508 Ga0501048_0143508_21_500 150
11 3300050511 nmdc:mga08y16_1666388_c1 nmdc:mga08y16_1666388_c1_132_584 150
12 3300005535 Ga0070684_101924730 Ga0070684_1019247301 154
13 3300025936 Ga0207670_11423036 Ga0207670_114230361 155
14 3300046514 Ga0495618_0552047 Ga0495618_0552047_191_661 155
15 3300005530 Ga0070679_100876332 Ga0070679_1008763322 156
16 3300039437 Ga0436365_1084136 Ga0436365_1084136_54_527 156
17 3300005329 Ga0070683_101209378 Ga0070683_1012093781 157
18 3300005467 Ga0070706_100235847 Ga0070706_1002358471 157
19 3300005535 Ga0070684_101734543 Ga0070684_1017345431 157
20 3300005536 Ga0070697_100661346 Ga0070697_1006613462 157
21 3300005577 Ga0068857_100341096 Ga0068857_1003410962 157
22 3300005843 Ga0068860_100325439 Ga0068860_1003254392 157
23 3300006028 Ga0070717_10031016 Ga0070717_100310164 157
24 3300006028 Ga0070717_10556417 Ga0070717_105564172 157
25 3300006844 Ga0075428_100030825 Ga0075428_1000308255 157
26 3300009093 Ga0105240_11845489 Ga0105240_118454891 157
27 3300014325 Ga0163163_12386836 Ga0163163_123868361 157
28 3300025910 Ga0207684_11166396 Ga0207684_111663962 157
29 3300025936 Ga0207670_10543566 Ga0207670_105435661 157
30 3300028381 Ga0268264_10105900 Ga0268264_101059002 157
31 3300028800 Ga0265338_10001664 Ga0265338_1000166432 157
32 3300031238 Ga0265332_10023067 Ga0265332_100230673 157
33 3300031241 Ga0265325_10001093 Ga0265325_100010938 157
34 3300031249 Ga0265339_10000368 Ga0265339_1000036820 157
35 3300031250 Ga0265331_10012364 Ga0265331_100123642 157
36 3300031595 Ga0265313_10000050 Ga0265313_1000005015 157
37 3300031711 Ga0265314_10000306 Ga0265314_1000030615 157
38 3300031712 Ga0265342_10003624 Ga0265342_1000362410 157
39 3300037853 Ga0436364_0220917 Ga0436364_0220917_494_976 157
40 3300037853 Ga0436364_0368215 Ga0436364_0368215_237_719 157
41 3300037853 Ga0436364_0655349 Ga0436364_0655349_15_494 157
42 3300037853 Ga0436364_1071435 Ga0436364_1071435_130_612 157
43 3300038705 Ga0237819_08651 Ga0237819_08651_320_802 157
44 3300039437 Ga0436365_1025936 Ga0436365_1025936_873_1355 157
45 3300039438 Ga0436360_0291162 Ga0436360_0291162_135_614 157
46 3300039438 Ga0436360_0506319 Ga0436360_0506319_328_834 157
47 3300039438 Ga0436360_0570968 Ga0436360_0570968_84_563 157
48 3300039438 Ga0436360_0681378 Ga0436360_0681378_312_797 157
49 3300039438 Ga0436360_0743454 Ga0436360_0743454_287_766 157
50 3300039438 Ga0436360_0782874 Ga0436360_0782874_56_538 157
51 3300039438 Ga0436360_0839236 Ga0436360_0839236_373_852 157
52 3300039450 Ga0436363_0201646 Ga0436363_0201646_106_585 157
53 3300039450 Ga0436363_0271177 Ga0436363_0271177_63_560 157
54 3300039453 Ga0436362_0530901 Ga0436362_0530901_118_597 157
55 3300045976 Ga0466967_0807420 Ga0466967_0807420_244_726 157
56 3300046511 Ga0495608_0032607 Ga0495608_0032607_1578_2057 157
57 3300046529 Ga0495652_0231172 Ga0495652_0231172_799_1278 157
58 3300046559 Ga0495667_0053715 Ga0495667_0053715_1129_1608 157
59 3300046663 Ga0495635_1020733 Ga0495635_1020733_33_515 157
60 3300046809 Ga0495600_0776655 Ga0495600_0776655_57_539 157
61 3300047317 Ga0495604_0118767 Ga0495604_0118767_1216_1695 157
62 3300047444 Ga0495675_0013046 Ga0495675_0013046_3238_3717 157
63 3300048911 Ga0496108_0150606 Ga0496108_0150606_1073_1555 157
64 3300048914 Ga0496111_0463833 Ga0496111_0463833_417_896 157
65 3300048914 Ga0496111_0503825 Ga0496111_0503825_163_645 157
66 3300049570 Ga0501033_0062896 Ga0501033_0062896_890_1402 157
67 3300049571 Ga0501034_0008747 Ga0501034_0008747_6505_6984 157
68 3300049571 Ga0501034_0257991 Ga0501034_0257991_956_1468 157
69 3300049572 Ga0501036_0059091 Ga0501036_0059091_1430_1942 157
70 3300049580 Ga0501046_0010198 Ga0501046_0010198_7300_7812 157
71 3300049581 Ga0501047_0464323 Ga0501047_0464323_526_1038 157
72 3300049582 Ga0501048_0509694 Ga0501048_0509694_328_810 157
73 3300049582 Ga0501048_0697714 Ga0501048_0697714_96_608 157
74 3300049587 Ga0501071_0202882 Ga0501071_0202882_681_1172 157
75 3300049823 Ga0501044_0280109 Ga0501044_0280109_958_1470 157
76 3300049823 Ga0501044_0494659 Ga0501044_0494659_333_824 157
77 3300053077 Ga0495601_0000687 Ga0495601_0000687_15220_15702 157
78 3300054114 Ga0501084_0010693 Ga0501084_0010693_7104_7586 157
79 3300054114 Ga0501084_0682696 Ga0501084_0682696_44_526 157
80 3300005937 Ga0081455_10036281 Ga0081455_100362814 159
81 3300049571 Ga0501034_0009671 Ga0501034_0009671_4977_5456 159
82 3300049575 Ga0501039_0372441 Ga0501039_0372441_503_982 159
83 3300049581 Ga0501047_0975528 Ga0501047_0975528_141_620 159
84 3300049823 Ga0501044_0220788 Ga0501044_0220788_718_1197 159
85 3300005435 Ga0070714_100229601 Ga0070714_1002296012 160
86 3300005436 Ga0070713_101277868 Ga0070713_1012778682 160
87 3300005578 Ga0068854_101126642 Ga0068854_1011266421 160
88 3300005841 Ga0068863_100985930 Ga0068863_1009859302 160
89 3300005843 Ga0068860_100267035 Ga0068860_1002670352 160
90 3300006844 Ga0075428_100011802 Ga0075428_1000118026 160
91 3300006844 Ga0075428_100046276 Ga0075428_1000462763 160
92 3300006852 Ga0075433_10184819 Ga0075433_101848192 160
93 3300006871 Ga0075434_100708365 Ga0075434_1007083651 160
94 3300009094 Ga0111539_10345082 Ga0111539_103450822 160
95 3300009098 Ga0105245_10853911 Ga0105245_108539112 160
96 3300009147 Ga0114129_11601119 Ga0114129_116011191 160
97 3300025921 Ga0207652_10754603 Ga0207652_107546032 160
98 3300025929 Ga0207664_10257999 Ga0207664_102579993 160
99 3300025961 Ga0207712_11043357 Ga0207712_110433572 160
100 3300028381 Ga0268264_10552030 Ga0268264_105520302 160
101 3300035725 Ga0373947_0620758 Ga0373947_0620758_65_547 160
102 3300039437 Ga0436365_1611034 Ga0436365_1611034_37_528 160
103 3300039438 Ga0436360_1015676 Ga0436360_1015676_106_597 160
104 3300046517 Ga0495630_0158848 Ga0495630_0158848_814_1296 160
105 3300046535 Ga0495586_0354386 Ga0495586_0354386_275_757 160
106 3300048917 Ga0496114_0247012 Ga0496114_0247012_900_1382 160
107 3300049744 Ga0501083_0049476 Ga0501083_0049476_582_1064 160
108 3300050491 nmdc:mga00v17_745320_c1 nmdc:mga00v17_745320_c1_27_509 160
109 3300050512 nmdc:mga0n895_1025768_c1 nmdc:mga0n895_1025768_c1_41_523 160
110 3300050515 nmdc:mga0a205_498276_c1 nmdc:mga0a205_498276_c1_375_857 160
111 3300060353 Ga0501082_1341958 Ga0501082_1341958_54_539 160
112 2162886011 MRS1b_contig_1715966 MRS1b_0721.00002300 161
113 3300005289 Ga0065704_10091856 Ga0065704_100918563 161
114 3300005290 Ga0065712_10068598 Ga0065712_100685987 161
115 3300005295 Ga0065707_10086907 Ga0065707_100869077 161
116 3300005340 Ga0070689_100141242 Ga0070689_1001412422 161
117 3300005544 Ga0070686_100087411 Ga0070686_1000874112 161
118 3300005842 Ga0068858_100178583 Ga0068858_1001785832 161
119 3300005937 Ga0081455_10611493 Ga0081455_106114932 161
120 3300006163 Ga0070715_10408964 Ga0070715_104089642 161
121 3300009094 Ga0111539_11761101 Ga0111539_117611012 161
122 3300009101 Ga0105247_10031510 Ga0105247_100315102 161
123 3300009174 Ga0105241_10492535 Ga0105241_104925352 161
124 3300009176 Ga0105242_10774537 Ga0105242_107745371 161
125 3300010375 Ga0105239_10190747 Ga0105239_101907472 161
126 3300010375 Ga0105239_10793067 Ga0105239_107930672 161
127 3300011119 Ga0105246_10349121 Ga0105246_103491212 161
128 3300014325 Ga0163163_10327921 Ga0163163_103279212 161
129 3300025900 Ga0207710_10090199 Ga0207710_100901992 161
130 3300025936 Ga0207670_10087144 Ga0207670_100871442 161
131 3300025961 Ga0207712_10330230 Ga0207712_103302302 161
132 3300026121 Ga0207683_10953732 Ga0207683_109537321 161
133 3300028380 Ga0268265_10373718 Ga0268265_103737182 161
134 3300028381 Ga0268264_10920249 Ga0268264_109202492 161
135 3300028577 Ga0265318_10127153 Ga0265318_101271532 161
136 3300031241 Ga0265325_10016786 Ga0265325_100167863 161
137 3300035398 Ga0316574_0114446 Ga0316574_0114446_475_972 161
138 3300035695 Ga0373927_0590948 Ga0373927_0590948_220_711 161
139 3300037068 Ga0373925_0640181 Ga0373925_0640181_227_715 161
140 3300048088 Ga0495602_0239466 Ga0495602_0239466_806_1294 161
141 3300048908 Ga0496105_0717358 Ga0496105_0717358_228_719 161
142 3300048911 Ga0496108_0996164 Ga0496108_0996164_124_657 161
143 3300048918 Ga0496115_0122308 Ga0496115_0122308_110_595 161
144 3300049571 Ga0501034_0004966 Ga0501034_0004966_2687_3226 161
145 3300049571 Ga0501034_0145045 Ga0501034_0145045_1209_1697 161
146 3300049579 Ga0501043_0011830 Ga0501043_0011830_3529_4041 161
147 3300049581 Ga0501047_0039013 Ga0501047_0039013_1333_1845 161
148 3300049586 Ga0501070_0000362 Ga0501070_0000362_16465_16977 161
149 3300049742 Ga0501080_0586186 Ga0501080_0586186_297_809 161
150 3300049743 Ga0501081_0780234 Ga0501081_0780234_113_601 161
151 3300050511 nmdc:mga08y16_1762162_c1 nmdc:mga08y16_1762162_c1_14_499 161
152 3300053077 Ga0495601_0203398 Ga0495601_0203398_689_1180 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

16

161

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p7c-assembly1.cif.gz_E complex i from e. coli, ddm/lmng-purified, apo, open state 0.9444 8 161
7p7c-assembly1.cif.gz_E complex i from e. coli, ddm/lmng-purified, apo, open state 0.9214 8 161
6zjy-assembly1.cif.gz_2 respiratory complex i from thermus thermophilus, nad+ dataset, minor state 0.9178 8 160
3iam-assembly1.cif.gz_2 crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh 0.9128 10 160
8b9z-assembly1.cif.gz_E drosophila melanogaster complex i in the active state (dm1) 0.8987 3 160
ID Description Score Start End Superfamily
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9779 79 160 3.40.30.10
af_P9WIV5_106_200_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9771 79 160 3.40.30.10
af_P0AFD1_13_82_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9641 8 76 1.10.10.1590
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9616 78 159 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9395 78 159 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1J5I2U2-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9647 34 160 GO:0016491
GO:0046872
GO:0051537
AF-A0A7X6THV4-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9625 38 161 GO:0016491
GO:0046872
GO:0051537
AF-A0A4D6YB24-F1-model_v4 NADH-quinone oxidoreductase subunit E (NADH dehydrogenase I subunit E) (NDH-1 subunit E) 0.958 8 159 GO:0003954
GO:0046872
GO:0051537
AF-A0A524QY59-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9567 34 157 GO:0016491
GO:0046872
GO:0051537
AF-A0A177Q030-F1-model_v4 deleted 0.9565 8 160

Feature Viewer

pLDDT pTM Quality
93.77 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map