F213980

General Info

Members Datasets Scaffolds Average Seq Length
152 96 304 313

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10050101|Ga0075367_100501012
Length 356
Sequence VTELRTHPDLPEITLPPGQGGMIPPPIALPDVLPTDRLNGRGMPLPFLRDDLRRIPNVRNAANVVSVWAQSFGLIAFVCWLTPSLPLAVAIVAWAVTFVLMGRAFALYAILGHEAAHRLLFSKKKVNDVVGRWAVAYPAFVPLDVYRRSHFAHHKDEFGPNEPDLNLYNRYPVTKASLRRKLVRDARGVSGWKNLKGLLGAFKSETARPVATKIAISQVTVALALLAIGGPSRWWLYPVLWLGPWLTVWRVINRLRSIAEHGGMTRSNDRRLTTHVVRQSLLARFWMVPFNTGWHLAHHVDMGVPFQNLPRLHDELVASGWVTEELEYPSYRALWRALSDAAEAPAVIHAASQDLV

Samples

Sample ID Description Type Environment
1 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
2 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
27 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
28 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
38 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
41 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
42 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
43 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
44 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
45 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
46 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
47 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
48 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
49 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
50 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
51 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
52 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
53 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
54 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
57 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
58 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
59 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
60 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
61 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
62 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
75 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
76 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
77 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
78 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
79 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
80 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
81 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
82 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
85 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
86 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
87 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
88 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
91 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
92 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
93 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
94 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
95 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
96 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.55
Nodule 0
Rhizoplane 1.32
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 7.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075367_10050101 3300006178 Bacteria 2464
2 Ga0070675_100148262 3300005354 Bacteria 2010
3 Ga0070671_100005335 3300005355 Bacteria 10248
4 Ga0070714_100164918 3300005435 Bacteria 2007
5 Ga0070705_100082635 3300005440 Bacteria 1977
6 Ga0070694_100108409 3300005444 Bacteria 1975
7 Ga0070708_100329391 3300005445 Bacteria 1439
8 Ga0070681_10025213 3300005458 Bacteria 5981
9 Ga0070699_100117260 3300005518 Bacteria 2340
10 Ga0070697_100345699 3300005536 Bacteria 1284
11 Ga0070695_100030451 3300005545 Bacteria 3361
12 Ga0070696_100306450 3300005546 Unclassified 1218
13 Ga0070704_100116300 3300005549 Bacteria 2045
14 Ga0068855_100055351 3300005563 Bacteria 4660
15 Ga0068861_100412434 3300005719 Bacteria 1201
16 Ga0068863_100399975 3300005841 Bacteria 1343
17 Ga0075365_10035296 3300006038 Bacteria 3234
18 Ga0075365_10044579 3300006038 Bacteria 2907
19 Ga0075365_10059949 3300006038 Bacteria 2538
20 Ga0075365_10105560 3300006038 Bacteria 1932
21 Ga0075367_10125150 3300006178 Bacteria 1586
22 Ga0075428_100257138 3300006844 Bacteria 1881
23 Ga0075430_100007649 3300006846 Bacteria 9127
24 Ga0075431_100011997 3300006847 Bacteria 8742
25 Ga0075429_100000767 3300006880 Bacteria 25306
26 Ga0114129_10162943 3300009147 Bacteria 3044
27 Ga0157375_10619657 3300013308 Bacteria 1240
28 Ga0163163_10200196 3300014325 Bacteria 2045
29 Ga0157380_10474481 3300014326 Bacteria 1208
30 Ga0163161_10038564 3300017792 Bacteria 3427
31 Ga0213876_10030258 3300021384 Bacteria 2855
32 Ga0207684_10184610 3300025910 Bacteria 1798
33 Ga0207707_10103358 3300025912 Bacteria 2490
34 Ga0207664_10317794 3300025929 Bacteria 1373
35 Ga0207644_10004661 3300025931 Bacteria 8911
36 Ga0207667_10099844 3300025949 Bacteria 2995
37 Ga0207703_10008047 3300026035 Bacteria 8332
38 Ga0207648_10358868 3300026089 Bacteria 1315
39 Ga0207675_100170306 3300026118 Bacteria 2081
40 Ga0207675_100382942 3300026118 Unclassified 1383
41 Ga0207683_10197647 3300026121 Unclassified 1827
42 Ga0265338_10072284 3300028800 Bacteria 2946
43 Ga0265770_1004181 3300030878 Unclassified 1967
44 Ga0265327_10000134 3300031251 Bacteria 163243
45 Ga0316576_10020894 3300031727 Bacteria 4517
46 Ga0316576_10050442 3300031727 Bacteria 3027
47 Ga0316576_10076343 3300031727 Bacteria 2479
48 Ga0316576_10089315 3300031727 Bacteria 2295
49 Ga0316578_10158180 3300031728 Bacteria 1365
50 Ga0316578_10244974 3300031728 Bacteria 1076
51 Ga0316577_10039120 3300031733 Bacteria 2654
52 Ga0316577_10054905 3300031733 Bacteria 2223
53 Ga0316580_10014676 3300032139 Unclassified 2393
54 Ga0373948_0000637 3300034817 Bacteria 4519
55 Ga0316574_0025829 3300035398 Bacteria 3528
56 Ga0316574_0068231 3300035398 Bacteria 2242
57 Ga0316574_0079239 3300035398 Unclassified 2083
58 Ga0316574_0103977 3300035398 Bacteria 1818
59 Ga0316574_0105407 3300035398 Unclassified 1806
60 Ga0373931_0000014 3300035691 Bacteria 251374
61 Ga0316582_0028824 3300036647 Bacteria 3367
62 Ga0316584_0006476 3300036712 Bacteria 7929
63 Ga0316584_0020525 3300036712 Bacteria 4791
64 Ga0316584_0030297 3300036712 Bacteria 3997
65 Ga0316584_0103192 3300036712 Bacteria 2135
66 Ga0316584_0209649 3300036712 Bacteria 1435
67 Ga0400483_042859 3300039062 Bacteria 9835
68 Ga0436365_1901632 3300039437 Bacteria 25356
69 Ga0451802_2016394 3300041460 Unclassified 1790
70 Ga0451853_0998868 3300041512 Unclassified 2766
71 Ga0439462_0021604 3300042015 Bacteria 1682
72 Ga0439434_0017413 3300042435 Unclassified 2150
73 Ga0466961_0078027 3300044693 Bacteria 2098
74 Ga0495639_0043895 3300046475 Bacteria 2020
75 Ga0495584_0175590 3300046491 Bacteria 1089
76 Ga0495672_0002606 3300047320 Bacteria 16350
77 Ga0495680_0197094 3300047322 Bacteria 1446
78 Ga0495684_0136592 3300047471 Bacteria 1840
79 Ga0496101_0228470 3300048904 Bacteria 1446
80 Ga0501031_0052787 3300049568 Bacteria 2649
81 Ga0501032_0009961 3300049569 Bacteria 6862
82 Ga0501032_0285321 3300049569 Unclassified 1068
83 Ga0501033_0027027 3300049570 Bacteria 4317
84 Ga0501033_0170635 3300049570 Bacteria 1562
85 Ga0501033_0213950 3300049570 Bacteria 1374
86 Ga0501034_0001582 3300049571 Bacteria 29653
87 Ga0501034_0001893 3300049571 Bacteria 26516
88 Ga0501034_0003015 3300049571 Bacteria 19477
89 Ga0501034_0050638 3300049571 Bacteria 4189
90 Ga0501034_0075627 3300049571 Bacteria 3374
91 Ga0501036_0487379 3300049572 Bacteria 1026
92 Ga0501037_0015365 3300049573 Bacteria 5633
93 Ga0501038_0025858 3300049574 Bacteria 5229
94 Ga0501038_0250047 3300049574 Bacteria 1405
95 Ga0501039_0460371 3300049575 Bacteria 999
96 Ga0501040_0217796 3300049576 Bacteria 1358
97 Ga0501042_0025829 3300049578 Bacteria 4128
98 Ga0501043_0023728 3300049579 Bacteria 4811
99 Ga0501047_0043096 3300049581 Bacteria 4360
100 Ga0501047_0063966 3300049581 Bacteria 3549
101 Ga0501047_0223679 3300049581 Bacteria 1738
102 Ga0501067_0071669 3300049583 Bacteria 1919
103 Ga0501067_0133501 3300049583 Bacteria 1382
104 Ga0501068_0000013 3300049584 Bacteria 62800
105 Ga0501069_0004972 3300049585 Bacteria 6896
106 Ga0501069_0054349 3300049585 Bacteria 2231
107 Ga0501070_0001042 3300049586 Bacteria 24971
108 Ga0501070_0001948 3300049586 Bacteria 18220
109 Ga0501070_0006326 3300049586 Bacteria 10077
110 Ga0501070_0032913 3300049586 Bacteria 4336
111 Ga0501070_0171322 3300049586 Bacteria 1788
112 Ga0501071_0002096 3300049587 Bacteria 11965
113 Ga0501071_0279412 3300049587 Bacteria 1264
114 Ga0501072_0009253 3300049588 Bacteria 7488
115 Ga0501073_0001051 3300049589 Bacteria 19911
116 Ga0501073_0001202 3300049589 Bacteria 18874
117 Ga0501073_0120154 3300049589 Bacteria 1821
118 Ga0501073_0201370 3300049589 Bacteria 1377
119 Ga0501073_0260278 3300049589 Bacteria 1197
120 Ga0501074_0006859 3300049590 Bacteria 8224
121 Ga0501074_0034972 3300049590 Bacteria 3641
122 Ga0501074_0038272 3300049590 Bacteria 3476
123 Ga0501074_0061565 3300049590 Bacteria 2704
124 Ga0501079_0002112 3300049741 Bacteria 14285
125 Ga0501079_0002398 3300049741 Bacteria 13581
126 Ga0501079_0028108 3300049741 Bacteria 4314
127 Ga0501079_0254138 3300049741 Bacteria 1374
128 Ga0501080_0003683 3300049742 Bacteria 13518
129 Ga0501080_0011291 3300049742 Bacteria 8175
130 Ga0501080_0027388 3300049742 Bacteria 5299
131 Ga0501080_0040284 3300049742 Bacteria 4357
132 Ga0501080_0058279 3300049742 Bacteria 3595
133 Ga0501080_0337758 3300049742 Unclassified 1362
134 Ga0501083_0004203 3300049744 Bacteria 10138
135 Ga0501044_0002367 3300049823 Bacteria 21465
136 Ga0501044_0005129 3300049823 Bacteria 14608
137 Ga0501044_0006033 3300049823 Bacteria 13377
138 Ga0501044_0228485 3300049823 Bacteria 1809
139 nmdc:mga00v17_4864_c1 3300050491 Bacteria 7040
140 nmdc:mga0yw44_303610_c1 3300050492 Bacteria 1070
141 nmdc:mga0yw44_74798_c1 3300050492 Bacteria 2110
142 nmdc:mga0yw44_86477_c1 3300050492 Bacteria 1974
143 nmdc:mga06z11_201102_c1 3300050494 Bacteria 1157
144 nmdc:mga05p37_192688_c1 3300050507 Bacteria 2473
145 nmdc:mga09592_21465_c1 3300050508 Bacteria 5320
146 nmdc:mga0qj67_2808_c1 3300050509 Bacteria 12487
147 nmdc:mga06r32_4372_c1 3300050510 Bacteria 12636
148 Ga0500566_0000162 3300053094 Bacteria 34256
149 Ga0500568_0000189 3300053139 Bacteria 53789
150 Ga0501084_0172643 3300054114 Bacteria 1825
151 Ga0501084_0562630 3300054114 Bacteria 963
152 Ga0501082_0099344 3300060353 Bacteria 2516
153 Ga0075367_10050101
154 Ga0070675_100148262
155 Ga0070671_100005335
156 Ga0070714_100164918
157 Ga0070705_100082635
158 Ga0070694_100108409
159 Ga0070708_100329391
160 Ga0070681_10025213
161 Ga0070699_100117260
162 Ga0070697_100345699
163 Ga0070695_100030451
164 Ga0070696_100306450
165 Ga0070704_100116300
166 Ga0068855_100055351
167 Ga0068861_100412434
168 Ga0068863_100399975
169 Ga0075365_10035296
170 Ga0075365_10044579
171 Ga0075365_10059949
172 Ga0075365_10105560
173 Ga0075367_10125150
174 Ga0075428_100257138
175 Ga0075430_100007649
176 Ga0075431_100011997
177 Ga0075429_100000767
178 Ga0114129_10162943
179 Ga0157375_10619657
180 Ga0163163_10200196
181 Ga0157380_10474481
182 Ga0163161_10038564
183 Ga0213876_10030258
184 Ga0207684_10184610
185 Ga0207707_10103358
186 Ga0207664_10317794
187 Ga0207644_10004661
188 Ga0207667_10099844
189 Ga0207703_10008047
190 Ga0207648_10358868
191 Ga0207675_100170306
192 Ga0207675_100382942
193 Ga0207683_10197647
194 Ga0265338_10072284
195 Ga0265770_1004181
196 Ga0265327_10000134
197 Ga0316576_10020894
198 Ga0316576_10050442
199 Ga0316576_10076343
200 Ga0316576_10089315
201 Ga0316578_10158180
202 Ga0316578_10244974
203 Ga0316577_10039120
204 Ga0316577_10054905
205 Ga0316580_10014676
206 Ga0373948_0000637
207 Ga0316574_0025829
208 Ga0316574_0068231
209 Ga0316574_0079239
210 Ga0316574_0103977
211 Ga0316574_0105407
212 Ga0373931_0000014
213 Ga0316582_0028824
214 Ga0316584_0006476
215 Ga0316584_0020525
216 Ga0316584_0030297
217 Ga0316584_0103192
218 Ga0316584_0209649
219 Ga0400483_042859
220 Ga0436365_1901632
221 Ga0451802_2016394
222 Ga0451853_0998868
223 Ga0439462_0021604
224 Ga0439434_0017413
225 Ga0466961_0078027
226 Ga0495639_0043895
227 Ga0495584_0175590
228 Ga0495672_0002606
229 Ga0495680_0197094
230 Ga0495684_0136592
231 Ga0496101_0228470
232 Ga0501031_0052787
233 Ga0501032_0009961
234 Ga0501032_0285321
235 Ga0501033_0027027
236 Ga0501033_0170635
237 Ga0501033_0213950
238 Ga0501034_0001582
239 Ga0501034_0001893
240 Ga0501034_0003015
241 Ga0501034_0050638
242 Ga0501034_0075627
243 Ga0501036_0487379
244 Ga0501037_0015365
245 Ga0501038_0025858
246 Ga0501038_0250047
247 Ga0501039_0460371
248 Ga0501040_0217796
249 Ga0501042_0025829
250 Ga0501043_0023728
251 Ga0501047_0043096
252 Ga0501047_0063966
253 Ga0501047_0223679
254 Ga0501067_0071669
255 Ga0501067_0133501
256 Ga0501068_0000013
257 Ga0501069_0004972
258 Ga0501069_0054349
259 Ga0501070_0001042
260 Ga0501070_0001948
261 Ga0501070_0006326
262 Ga0501070_0032913
263 Ga0501070_0171322
264 Ga0501071_0002096
265 Ga0501071_0279412
266 Ga0501072_0009253
267 Ga0501073_0001051
268 Ga0501073_0001202
269 Ga0501073_0120154
270 Ga0501073_0201370
271 Ga0501073_0260278
272 Ga0501074_0006859
273 Ga0501074_0034972
274 Ga0501074_0038272
275 Ga0501074_0061565
276 Ga0501079_0002112
277 Ga0501079_0002398
278 Ga0501079_0028108
279 Ga0501079_0254138
280 Ga0501080_0003683
281 Ga0501080_0011291
282 Ga0501080_0027388
283 Ga0501080_0040284
284 Ga0501080_0058279
285 Ga0501080_0337758
286 Ga0501083_0004203
287 Ga0501044_0002367
288 Ga0501044_0005129
289 Ga0501044_0006033
290 Ga0501044_0228485
291 nmdc:mga00v17_4864_c1
292 nmdc:mga0yw44_303610_c1
293 nmdc:mga0yw44_74798_c1
294 nmdc:mga0yw44_86477_c1
295 nmdc:mga06z11_201102_c1
296 nmdc:mga05p37_192688_c1
297 nmdc:mga09592_21465_c1
298 nmdc:mga0qj67_2808_c1
299 nmdc:mga06r32_4372_c1
300 Ga0500566_0000162
301 Ga0500568_0000189
302 Ga0501084_0172643
303 Ga0501084_0562630
304 Ga0501082_0099344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

88

332

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f6t-assembly1.cif.gz_A cryo-em structure of alkane 1-monooxygenase alkb-alkg complex from fontimonas thermophila 0.5375 33 328
8f6t-assembly1.cif.gz_A cryo-em structure of alkane 1-monooxygenase alkb-alkg complex from fontimonas thermophila 0.4912 33 328
8e0m-assembly3.cif.gz_I homotrimeric variant of tctrp9, bgl15 0.3931 65 209
8e12-assembly1.cif.gz_C homotrimeric variant of tctrp9, bgl14 0.3633 48 233
8e0m-assembly4.cif.gz_K homotrimeric variant of tctrp9, bgl15 0.3408 65 214
ID Description Score Start End Superfamily
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6311 85 318 3.30.40.10
af_H2L011_173_278_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5678 56 142 1.20.120.230
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5534 85 318 3.30.40.10
af_H2L011_173_278_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4725 56 142 1.20.120.230
af_D4A739_168_277_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4028 68 208 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A535M265-F1-model_v4 Fatty acid desaturase domain-containing protein 0.9805 126 327 GO:0006629
AF-A0A6J7Q7E1-F1-model_v4 Unannotated protein 0.9794 95 328 GO:0006629
AF-A0A7W0UL47-F1-model_v4 Fatty acid desaturase 0.9788 14 328 GO:0016020
GO:0042284
GO:0046513
AF-A0A0J0UYA8-F1-model_v4 Fatty acid desaturase 0.9759 23 328 GO:0016020
GO:0042284
GO:0046513
AF-A0A6J7L3V9-F1-model_v4 Unannotated protein 0.9714 23 327 GO:0006629
GO:0016020

Map