F213394

General Info

Members Datasets Scaffolds Average Seq Length
152 126 304 137

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100992992|Ga0070683_1009929922
Length 152
Sequence VLAWSRRSSVAGVDTTVVTLTTGGSPRVEDLTRRCQDWLGEVGAQDGLLHVFVPHATAGVAIIETGAGSDDDLVAALDVLLPATGPHGRGWRHAHGSRGHGRDHVLPAFVRPDATVPVVGGRLALGTWQSVVLVDTNVDNPQRQVRLSFLAG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
32 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
41 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
42 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
43 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
51 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
52 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
57 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
58 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
59 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
60 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
64 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
72 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
73 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
74 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
80 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
81 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
82 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
86 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
116 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
117 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
118 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
119 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
120 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
121 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
122 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
123 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
124 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
125 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
126 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.76
Metatranscriptomes 0.66
Isolates 6.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.66
Rhizoplane 5.92
Rhizosphere 88.82
Stem 0
Stem Tuber 0
Unclassified 3.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100992992 3300005329 Bacteria 806
2 JGI25406J46586_10012720 3300003203 Bacteria 3637
3 Ga0070658_10085889 3300005327 Bacteria 2588
4 Ga0070690_100982327 3300005330 Bacteria 664
5 Ga0070660_100618996 3300005339 Bacteria 906
6 Ga0070689_100502137 3300005340 Bacteria 1039
7 Ga0070661_100102124 3300005344 Bacteria 2134
8 Ga0070714_100086615 3300005435 Bacteria 2738
9 Ga0070714_100982085 3300005435 Bacteria 821
10 Ga0070713_100553497 3300005436 Bacteria 1089
11 Ga0070713_100571447 3300005436 Bacteria 1072
12 Ga0070710_10000407 3300005437 Bacteria 20200
13 Ga0070708_100206423 3300005445 Bacteria 1840
14 Ga0070662_101024042 3300005457 Bacteria 707
15 Ga0070685_10515710 3300005466 Bacteria 848
16 Ga0070698_100024119 3300005471 Bacteria 6348
17 Ga0070698_100110702 3300005471 Bacteria 2711
18 Ga0068855_100007365 3300005563 Bacteria 13323
19 Ga0068855_100372887 3300005563 Bacteria 1568
20 Ga0081455_10964575 3300005937 Bacteria 528
21 Ga0081540_1001519 3300005983 Bacteria 19942
22 Ga0070717_10046987 3300006028 Bacteria 3535
23 Ga0075432_10000676 3300006058 Bacteria 10488
24 Ga0075430_101080478 3300006846 Bacteria 661
25 Ga0075431_100798587 3300006847 Bacteria 917
26 Ga0114129_10583263 3300009147 Bacteria 1450
27 Ga0105243_12686775 3300009148 Bacteria 538
28 Ga0105241_10615011 3300009174 Bacteria 983
29 Ga0105248_11299570 3300009177 Bacteria 823
30 Ga0157370_10011259 3300013104 Bacteria 9378
31 Ga0157372_10704597 3300013307 Bacteria 1175
32 Ga0157372_12699875 3300013307 Bacteria 570
33 Ga0157375_10673276 3300013308 Bacteria 1190
34 Ga0157380_10971683 3300014326 Bacteria 881
35 Ga0197907_10547407 3300020069 Bacteria 1761
36 Ga0213873_10057733 3300021358 Bacteria 1043
37 Ga0207692_10000756 3300025898 Bacteria 11438
38 Ga0207659_10694686 3300025926 Bacteria 871
39 Ga0207664_10230007 3300025929 Bacteria 1611
40 Ga0207664_10952813 3300025929 Bacteria 770
41 Ga0207664_11611904 3300025929 Bacteria 571
42 Ga0207691_11072041 3300025940 Bacteria 671
43 Ga0207711_11386026 3300025941 Unclassified 645
44 Ga0207689_10031432 3300025942 Bacteria 4420
45 Ga0207683_11543702 3300026121 Bacteria 613
46 Ga0265338_10466433 3300028800 Bacteria 893
47 Ga0316177_1026019 3300030731 Bacteria 5294
48 Ga0316176_1146810 3300030732 Bacteria 5163
49 Ga0314311_1029333 3300030733 Bacteria 2826
50 Ga0316180_1087853 3300030736 Bacteria 898
51 Ga0307408_100529925 3300031548 Bacteria 1036
52 Ga0307508_10078149 3300031616 Bacteria 2889
53 Ga0307413_10000248 3300031824 Bacteria 16228
54 Ga0307410_10942115 3300031852 Unclassified 742
55 Ga0307406_10342902 3300031901 Bacteria 1164
56 Ga0307406_10716013 3300031901 Bacteria 837
57 Ga0307407_10142428 3300031903 Unclassified 1548
58 Ga0307507_10053127 3300033179 Bacteria 3874
59 Ga0316574_0034229 3300035398 Bacteria 3096
60 Ga0373924_0000791 3300035410 Bacteria 9860
61 Ga0395900_0515157 3300037418 Bacteria 1145
62 Ga0395898_0573376 3300037466 Bacteria 1071
63 Ga0395901_0189307 3300038443 Bacteria 2158
64 Ga0439463_004361 3300042016 Bacteria 3546
65 Ga0439464_0032949 3300042439 Bacteria 1457
66 Ga0466972_0013442 3300044658 Bacteria 4110
67 Ga0466965_0006058 3300044683 Bacteria 5465
68 Ga0466965_0008714 3300044683 Bacteria 4697
69 Ga0466965_0009360 3300044683 Bacteria 4551
70 Ga0466965_0075071 3300044683 Bacteria 1704
71 Ga0466966_0030203 3300044684 Bacteria 3520
72 Ga0466961_0011096 3300044693 Bacteria 5760
73 Ga0466961_0034058 3300044693 Bacteria 3271
74 Ga0466961_0034168 3300044693 Bacteria 3265
75 Ga0466963_0148230 3300044694 Bacteria 1629
76 Ga0466963_0191071 3300044694 Bacteria 1430
77 Ga0466963_0273235 3300044694 Bacteria 1187
78 Ga0466964_0215535 3300044706 Bacteria 929
79 Ga0466971_0022262 3300044719 Bacteria 2823
80 Ga0466971_0036778 3300044719 Bacteria 2195
81 Ga0466957_0010459 3300044842 Bacteria 5330
82 Ga0466960_0005329 3300044901 Bacteria 5087
83 Ga0466960_0005956 3300044901 Bacteria 4863
84 Ga0466960_0448300 3300044901 Bacteria 750
85 Ga0466959_0089550 3300045049 Bacteria 2211
86 Ga0466959_0217800 3300045049 Bacteria 1325
87 Ga0466958_0000933 3300045836 Bacteria 13184
88 Ga0466967_0175285 3300045976 Bacteria 2020
89 Ga0466967_0413367 3300045976 Bacteria 1314
90 Ga0466967_0737659 3300045976 Bacteria 976
91 Ga0495629_0221725 3300046459 Bacteria 1304
92 Ga0495651_0012847 3300046462 Bacteria 6469
93 Ga0495662_0283321 3300046476 Bacteria 816
94 Ga0495584_0397033 3300046491 Bacteria 701
95 Ga0495585_0063599 3300046492 Bacteria 2025
96 Ga0495585_0169155 3300046492 Bacteria 1130
97 Ga0495594_0065027 3300046499 Bacteria 2023
98 Ga0495618_0607881 3300046514 Bacteria 650
99 Ga0495628_0007647 3300046516 Bacteria 9342
100 Ga0495630_1170209 3300046517 Bacteria 582
101 Ga0495663_0305461 3300046525 Bacteria 573
102 Ga0495640_0015539 3300046533 Bacteria 5725
103 Ga0495656_0559768 3300046615 Unclassified 610
104 Ga0495659_0541838 3300046664 Bacteria 513
105 Ga0495658_0870182 3300046683 Bacteria 576
106 Ga0495613_0043574 3300046689 Bacteria 3319
107 Ga0495600_0388031 3300046809 Bacteria 870
108 Ga0495581_0270764 3300047315 Bacteria 993
109 Ga0495676_0139153 3300047321 Bacteria 1741
110 Ga0495676_0439407 3300047321 Bacteria 862
111 Ga0495677_0145826 3300047445 Unclassified 910
112 Ga0496102_0562718 3300048905 Bacteria 1063
113 Ga0496104_0707379 3300048907 Bacteria 915
114 Ga0496105_0880155 3300048908 Bacteria 676
115 Ga0496109_0041574 3300048912 Bacteria 4164
116 Ga0496110_0021622 3300048913 Bacteria 5451
117 Ga0496110_1102866 3300048913 Bacteria 702
118 Ga0496111_1211895 3300048914 Bacteria 534
119 Ga0496112_0388965 3300048915 Bacteria 1335
120 Ga0496114_0070763 3300048917 Bacteria 2931
121 Ga0501031_0245036 3300049568 Bacteria 1165
122 Ga0501032_0032054 3300049569 Bacteria 3602
123 Ga0501033_0316061 3300049570 Bacteria 1097
124 Ga0501034_0314798 3300049571 Bacteria 1499
125 Ga0501036_1295172 3300049572 Bacteria 592
126 Ga0501038_0051616 3300049574 Bacteria 3548
127 Ga0501039_0289918 3300049575 Bacteria 1287
128 Ga0501042_1157195 3300049578 Bacteria 564
129 Ga0501043_0599009 3300049579 Bacteria 814
130 Ga0501046_0384685 3300049580 Bacteria 1015
131 Ga0501047_0316164 3300049581 Bacteria 1402
132 Ga0501070_0192079 3300049586 Bacteria 1678
133 Ga0501071_0626311 3300049587 Bacteria 827
134 Ga0501075_0380254 3300049591 Bacteria 1076
135 Ga0501035_0010440 3300049822 Bacteria 8608
136 Ga0501035_0102204 3300049822 Bacteria 2514
137 nmdc:mga05p37_595355_c1 3300050507 Bacteria 1249
138 nmdc:mga0qj67_940190_c1 3300050509 Bacteria 680
139 nmdc:mga0a205_66602_c1 3300050515 Bacteria 2585
140 Ga0466962_0014295 3300061719 Bacteria 3824
141 Ga0466962_0023618 3300061719 Bacteria 2954
142 Ga0530510_0017156 3300061734 Bacteria 5129
143 2832005548 2832004796 Bacteria 6538017
144 2858908814 2858902515 Bacteria 7086037
145 2863071193 2863067949 Bacteria 8541735
146 2866066568 2866065130 Bacteria 6518152
147 2880489469 2880489317 Bacteria 7096270
148 2929224895 2929219909 Bacteria 6984360
149 2995470968 2995463766 Bacteria 8577691
150 8003833820 8003830390 Bacteria 6541657
151 8054707979 8054704163 Bacteria 7247792
152 8056670320 8056667051 Bacteria 6953971
153 Ga0070683_100992992
154 JGI25406J46586_10012720
155 Ga0070658_10085889
156 Ga0070690_100982327
157 Ga0070660_100618996
158 Ga0070689_100502137
159 Ga0070661_100102124
160 Ga0070714_100086615
161 Ga0070714_100982085
162 Ga0070713_100553497
163 Ga0070713_100571447
164 Ga0070710_10000407
165 Ga0070708_100206423
166 Ga0070662_101024042
167 Ga0070685_10515710
168 Ga0070698_100024119
169 Ga0070698_100110702
170 Ga0068855_100007365
171 Ga0068855_100372887
172 Ga0081455_10964575
173 Ga0081540_1001519
174 Ga0070717_10046987
175 Ga0075432_10000676
176 Ga0075430_101080478
177 Ga0075431_100798587
178 Ga0114129_10583263
179 Ga0105243_12686775
180 Ga0105241_10615011
181 Ga0105248_11299570
182 Ga0157370_10011259
183 Ga0157372_10704597
184 Ga0157372_12699875
185 Ga0157375_10673276
186 Ga0157380_10971683
187 Ga0197907_10547407
188 Ga0213873_10057733
189 Ga0207692_10000756
190 Ga0207659_10694686
191 Ga0207664_10230007
192 Ga0207664_10952813
193 Ga0207664_11611904
194 Ga0207691_11072041
195 Ga0207711_11386026
196 Ga0207689_10031432
197 Ga0207683_11543702
198 Ga0265338_10466433
199 Ga0316177_1026019
200 Ga0316176_1146810
201 Ga0314311_1029333
202 Ga0316180_1087853
203 Ga0307408_100529925
204 Ga0307508_10078149
205 Ga0307413_10000248
206 Ga0307410_10942115
207 Ga0307406_10342902
208 Ga0307406_10716013
209 Ga0307407_10142428
210 Ga0307507_10053127
211 Ga0316574_0034229
212 Ga0373924_0000791
213 Ga0395900_0515157
214 Ga0395898_0573376
215 Ga0395901_0189307
216 Ga0439463_004361
217 Ga0439464_0032949
218 Ga0466972_0013442
219 Ga0466965_0006058
220 Ga0466965_0008714
221 Ga0466965_0009360
222 Ga0466965_0075071
223 Ga0466966_0030203
224 Ga0466961_0011096
225 Ga0466961_0034058
226 Ga0466961_0034168
227 Ga0466963_0148230
228 Ga0466963_0191071
229 Ga0466963_0273235
230 Ga0466964_0215535
231 Ga0466971_0022262
232 Ga0466971_0036778
233 Ga0466957_0010459
234 Ga0466960_0005329
235 Ga0466960_0005956
236 Ga0466960_0448300
237 Ga0466959_0089550
238 Ga0466959_0217800
239 Ga0466958_0000933
240 Ga0466967_0175285
241 Ga0466967_0413367
242 Ga0466967_0737659
243 Ga0495629_0221725
244 Ga0495651_0012847
245 Ga0495662_0283321
246 Ga0495584_0397033
247 Ga0495585_0063599
248 Ga0495585_0169155
249 Ga0495594_0065027
250 Ga0495618_0607881
251 Ga0495628_0007647
252 Ga0495630_1170209
253 Ga0495663_0305461
254 Ga0495640_0015539
255 Ga0495656_0559768
256 Ga0495659_0541838
257 Ga0495658_0870182
258 Ga0495613_0043574
259 Ga0495600_0388031
260 Ga0495581_0270764
261 Ga0495676_0139153
262 Ga0495676_0439407
263 Ga0495677_0145826
264 Ga0496102_0562718
265 Ga0496104_0707379
266 Ga0496105_0880155
267 Ga0496109_0041574
268 Ga0496110_0021622
269 Ga0496110_1102866
270 Ga0496111_1211895
271 Ga0496112_0388965
272 Ga0496114_0070763
273 Ga0501031_0245036
274 Ga0501032_0032054
275 Ga0501033_0316061
276 Ga0501034_0314798
277 Ga0501036_1295172
278 Ga0501038_0051616
279 Ga0501039_0289918
280 Ga0501042_1157195
281 Ga0501043_0599009
282 Ga0501046_0384685
283 Ga0501047_0316164
284 Ga0501070_0192079
285 Ga0501071_0626311
286 Ga0501075_0380254
287 Ga0501035_0010440
288 Ga0501035_0102204
289 nmdc:mga05p37_595355_c1
290 nmdc:mga0qj67_940190_c1
291 nmdc:mga0a205_66602_c1
292 Ga0466962_0014295
293 Ga0466962_0023618
294 Ga0530510_0017156
295 2832005548
296 2858908814
297 2863071193
298 2866066568
299 2880489469
300 2929224895
301 2995470968
302 8003833820
303 8054707979
304 8056670320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

30

149

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9111 22 156
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.8982 23 156
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.8968 25 154
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.8862 22 156
2p6h-assembly1.cif.gz_A crystal structure of hypothetical protein ape1520 from aeropyrum pernix k1 0.8823 24 156
ID Description Score Start End Superfamily
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9759 25 153 2.60.120.460
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9397 25 153 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8922 24 156 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.889 23 156 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8829 27 154 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A0S4R0L1-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9972 29 156
AF-A0A4R4LTD4-F1-model_v4 deleted 0.9953 39 156
AF-A0A7G9RBH8-F1-model_v4 YjbQ family protein 0.9951 24 156
AF-A0A5C8JLL2-F1-model_v4 YjbQ family protein 0.9942 24 156
AF-A0A5S4ZI95-F1-model_v4 deleted 0.9917 40 156

Map