F213226

General Info

Members Datasets Scaffolds Average Seq Length
152 118 145 165

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10000496|Ga0055531_1000049623
Length 190
Sequence MKNKRNALNESYLSAEGSMLIKSTKNMKKVIYMLILPLVVVSGLVFANREIKKETSEQSAPKPLSAAERKAELEKWEATPELAGAAKIKGQVRDSTNMEAVITSLSLPPGSRLGFGVMVRINGDDYILSFGLEKSNEFEQLHSLKVNDRIIIRSHFVSYAPKYSYPIVSGDYLERDGKMIYKRAPRTGGC

Samples

Sample ID Description Type Environment
1 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
2 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
3 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
4 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
5 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
6 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
7 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
89 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
90 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
91 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
94 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
95 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
96 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
97 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
103 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
104 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
107 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
110 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
111 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
112 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
113 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
114 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
115 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
116 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
117 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
118 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.74
Metatranscriptomes 0
Isolates 5.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.16
Nodule 0
Rhizoplane 0.66
Rhizosphere 75.66
Stem 0
Stem Tuber 0
Unclassified 10.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10002508 3300003215 Bacteria 10537
2 rootH1_10008437 3300003316 Bacteria 1748
3 rootH1_10010323 3300003316 Bacteria 13967
4 rootH2_10042054 3300003320 Bacteria 45299
5 rootL2_10050342 3300003322 Bacteria 13882
6 rootL2_10140137 3300003322 Bacteria 1076
7 rootL2_10179155 3300003322 Bacteria 2897
8 rootH1_10000712 3300003316 Bacteria 27638
9 rootH1_10000712 3300003323 Bacteria 88392
10 rootH1_10059131 3300003323 Bacteria 9486
11 JGI25160J50197_1001989 3300003354 Bacteria 9752
12 Ga0055542_1005537 3300003762 Bacteria 2832
13 Ga0055531_10000496 3300003794 Bacteria 36031
14 Ga0065712_10092200 3300005290 Bacteria 2337
15 Ga0070690_100257096 3300005330 Bacteria 1237
16 Ga0070690_100486772 3300005330 Bacteria 921
17 Ga0070670_100209249 3300005331 Bacteria 1696
18 Ga0068869_100109955 3300005334 Bacteria 2095
19 Ga0068869_100330351 3300005334 Bacteria 1239
20 Ga0068869_101347182 3300005334 Bacteria 631
21 Ga0070689_100598705 3300005340 Bacteria 955
22 Ga0070669_100211945 3300005353 Bacteria 1529
23 Ga0070671_100004840 3300005355 Bacteria 10706
24 Ga0070671_100268079 3300005355 Bacteria 1451
25 Ga0070674_100097445 3300005356 Bacteria 2136
26 Ga0070673_100267342 3300005364 Bacteria 1496
27 Ga0070673_100644031 3300005364 Bacteria 969
28 Ga0070678_100321401 3300005456 Bacteria 1322
29 Ga0068867_100013993 3300005459 Bacteria 5680
30 Ga0068867_100732378 3300005459 Bacteria 875
31 Ga0070684_101123569 3300005535 Bacteria 739
32 Ga0070686_100238554 3300005544 Bacteria 1322
33 Ga0070665_100000002 3300005548 Bacteria 849037
34 Ga0068855_100013103 3300005563 Bacteria 9998
35 Ga0070702_100052526 3300005615 Bacteria 2337
36 Ga0068852_100363777 3300005616 Bacteria 1415
37 Ga0068852_100453481 3300005616 Bacteria 1270
38 Ga0068866_10139921 3300005718 Bacteria 1388
39 Ga0068861_100672931 3300005719 Bacteria 959
40 Ga0068863_100261659 3300005841 Bacteria 1673
41 Ga0068860_100303821 3300005843 Bacteria 1564
42 Ga0081455_10408362 3300005937 Bacteria 940
43 Ga0068871_100070993 3300006358 Bacteria 2863
44 Ga0068865_100170802 3300006881 Bacteria 1667
45 Ga0068865_101076796 3300006881 Bacteria 707
46 Ga0105240_10221596 3300009093 Bacteria 2203
47 Ga0111539_10122425 3300009094 Bacteria 3048
48 Ga0105242_10254195 3300009176 Bacteria 1585
49 Ga0105249_10555899 3300009553 Bacteria 1199
50 Ga0105239_10000652 3300010375 Bacteria 49416
51 Ga0105239_10098547 3300010375 Bacteria 3231
52 Ga0157371_10032318 3300013102 Bacteria 3767
53 Ga0157369_10136934 3300013105 Bacteria 2592
54 Ga0157369_10150882 3300013105 Bacteria 2456
55 Ga0157374_10000027 3300013296 Bacteria 233444
56 Ga0157378_10024263 3300013297 Bacteria 5334
57 Ga0157378_10667300 3300013297 Bacteria 1057
58 Ga0157378_11084423 3300013297 Bacteria 837
59 Ga0157372_10138942 3300013307 Bacteria 2798
60 Ga0157372_10507597 3300013307 Bacteria 1406
61 Ga0157372_10913084 3300013307 Bacteria 1019
62 Ga0157372_11066096 3300013307 Bacteria 935
63 Ga0157375_10008085 3300013308 Bacteria 9202
64 Ga0157375_10186676 3300013308 Bacteria 2227
65 Ga0157380_10306686 3300014326 Bacteria 1465
66 Ga0157379_10300686 3300014968 Bacteria 1462
67 Ga0157376_10000368 3300014969 Bacteria 29611
68 Ga0157376_10020984 3300014969 Bacteria 5066
69 Ga0163161_10578316 3300017792 Bacteria 924
70 Ga0209258_100473 3300025242 Bacteria 42905
71 Ga0209646_1007032 3300025246 Bacteria 1861
72 Ga0209148_1000697 3300025254 Bacteria 27221
73 Ga0209758_1002136 3300025297 Bacteria 20845
74 Ga0207426_1000060 3300025302 Bacteria 363139
75 Ga0207426_1069500 3300025302 Bacteria 987
76 Ga0209257_1000001 3300025304 Bacteria 2274655
77 Ga0207645_10024382 3300025907 Bacteria 3923
78 Ga0207645_10039959 3300025907 Bacteria 3005
79 Ga0207662_10208782 3300025918 Bacteria 1267
80 Ga0207644_10003423 3300025931 Bacteria 10247
81 Ga0207644_10584581 3300025931 Bacteria 926
82 Ga0207706_10453565 3300025933 Bacteria 1109
83 Ga0207669_10085091 3300025937 Bacteria 2040
84 Ga0207711_11375040 3300025941 Bacteria 648
85 Ga0207689_10016089 3300025942 Bacteria 6331
86 Ga0207689_10565489 3300025942 Bacteria 955
87 Ga0207679_11070205 3300025945 Bacteria 740
88 Ga0207667_10007046 3300025949 Bacteria 13583
89 Ga0207712_10716165 3300025961 Bacteria 874
90 Ga0207658_10793602 3300025986 Bacteria 859
91 Ga0207703_10116387 3300026035 Bacteria 2288
92 Ga0207678_10281211 3300026067 Bacteria 1428
93 Ga0207678_11386241 3300026067 Bacteria 622
94 Ga0207708_10109881 3300026075 Bacteria 2139
95 Ga0207702_10605543 3300026078 Bacteria 1075
96 Ga0207648_10067254 3300026089 Bacteria 3124
97 Ga0207648_10168105 3300026089 Bacteria 1938
98 Ga0207683_10059417 3300026121 Bacteria 3358
99 Ga0207683_10343108 3300026121 Bacteria 1370
100 Ga0207698_10042518 3300026142 Bacteria 3396
101 Ga0207698_10998130 3300026142 Bacteria 848
102 Ga0207698_11363425 3300026142 Bacteria 724
103 Ga0268266_10000073 3300028379 Bacteria 232074
104 Ga0268264_10056789 3300028381 Bacteria 3273
105 Ga0307513_10314675 3300031456 Bacteria 1326
106 Ga0307408_100000404 3300031548 Bacteria 38790
107 Ga0307408_100004820 3300031548 Bacteria 9089
108 Ga0265313_10043572 3300031595 Bacteria 2197
109 Ga0307412_10005550 3300031911 Bacteria 7085
110 Ga0307412_10974448 3300031911 Bacteria 748
111 Ga0395900_0500624 3300037418 Bacteria 1165
112 Ga0395901_0183336 3300038443 Bacteria 2196
113 Ga0436365_1092683 3300039437 Bacteria 974
114 Ga0439439_0009433 3300041406 Bacteria 2321
115 Ga0439461_0021217 3300041410 Bacteria 1293
116 Ga0439466_0083004 3300041411 Bacteria 1010
117 Ga0451804_1029986 3300041463 Bacteria 1014
118 Ga0451853_3559548 3300041512 Bacteria 1387
119 Ga0439431_0028564 3300041997 Bacteria 1374
120 Ga0439442_009975 3300042002 Bacteria 1922
121 Ga0439449_0027826 3300042007 Bacteria 2109
122 Ga0439449_0157038 3300042007 Bacteria 849
123 Ga0439452_050191 3300042010 Bacteria 958
124 Ga0439446_0111860 3300042156 Bacteria 872
125 Ga0466972_0000039 3300044658 Bacteria 135618
126 Ga0466964_0157427 3300044706 Bacteria 1059
127 Ga0466960_0144841 3300044901 Bacteria 1265
128 Ga0495642_0286904 3300046528 Bacteria 721
129 Ga0495687_001847 3300047443 Bacteria 18509
130 Ga0495673_0231943 3300047469 Bacteria 680
131 Ga0501290_043875 3300049513 Bacteria 678
132 Ga0501034_0029706 3300049571 Bacteria 5557
133 Ga0501034_0422036 3300049571 Bacteria 1255
134 Ga0501253_070184 3300049683 Bacteria 772
135 nmdc:mga0k408_90561_c1 3300050493 Bacteria 1796
136 nmdc:mga08y16_306505_c1 3300050511 Bacteria 1636
137 Ga0500583_0000142 3300053092 Bacteria 30368
138 Ga0500651_0095440 3300053093 Bacteria 1828
139 Ga0500569_003936 3300053109 Bacteria 3083
140 Ga0500594_0112465 3300053118 Bacteria 848
141 Ga0500658_0002847 3300053134 Bacteria 6638
142 Ga0500589_167135 3300053147 Bacteria 878
143 Ga0500616_0084459 3300053153 Bacteria 1588
144 Ga0500622_0070694 3300053156 Bacteria 1765
145 Ga0500661_012866 3300055283 Bacteria 1509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10314675 Ga0307513_103146752 138
2 3300041463 Ga0451804_1029986 Ga0451804_1029986_74_589 138
3 3300041512 Ga0451853_3559548 Ga0451853_3559548_822_1313 138
4 3300053156 Ga0500622_0070694 Ga0500622_0070694_513_950 138
5 3300003316 rootH1_10010323 rootH1_100103233 139
6 3300053092 Ga0500583_0000142 Ga0500583_0000142_7547_8011 139
7 3300003323 rootH1_10059131 rootH1_100591319 140
8 3300005563 Ga0068855_100013103 Ga0068855_10001310313 140
9 3300017792 Ga0163161_10578316 Ga0163161_105783162 140
10 3300025949 Ga0207667_10007046 Ga0207667_100070469 140
11 3300026078 Ga0207702_10605543 Ga0207702_106055431 140
12 3300042007 Ga0439449_0027826 Ga0439449_0027826_1489_1956 140
13 3300047469 Ga0495673_0231943 Ga0495673_0231943_24_545 140
14 3300053118 Ga0500594_0112465 Ga0500594_0112465_158_721 142
15 3300005356 Ga0070674_100097445 Ga0070674_1000974453 144
16 3300005459 Ga0068867_100013993 Ga0068867_1000139934 144
17 3300005718 Ga0068866_10139921 Ga0068866_101399212 144
18 3300005719 Ga0068861_100672931 Ga0068861_1006729311 144
19 3300006881 Ga0068865_101076796 Ga0068865_1010767962 144
20 3300009176 Ga0105242_10254195 Ga0105242_102541952 144
21 3300013297 Ga0157378_10024263 Ga0157378_100242633 144
22 3300013307 Ga0157372_10913084 Ga0157372_109130841 144
23 3300025937 Ga0207669_10085091 Ga0207669_100850912 144
24 3300026089 Ga0207648_10168105 Ga0207648_101681052 144
25 3300009093 Ga0105240_10221596 Ga0105240_102215963 145
26 3300003762 Ga0055542_1005537 Ga0055542_10055372 146
27 3300005459 Ga0068867_100732378 Ga0068867_1007323782 146
28 3300025242 Ga0209258_100473 Ga0209258_10047314 146
29 3300025246 Ga0209646_1007032 Ga0209646_10070322 146
30 3300025254 Ga0209148_1000697 Ga0209148_100069716 146
31 3300025942 Ga0207689_10565489 Ga0207689_105654891 146
32 3300031548 Ga0307408_100004820 Ga0307408_1000048203 146
33 3300053109 Ga0500569_003936 Ga0500569_003936_2250_2816 146
34 3300053153 Ga0500616_0084459 Ga0500616_0084459_589_1155 146
35 3300005364 Ga0070673_100267342 Ga0070673_1002673422 147
36 3300005456 Ga0070678_100321401 Ga0070678_1003214012 147
37 3300013308 Ga0157375_10186676 Ga0157375_101866762 147
38 3300025907 Ga0207645_10024382 Ga0207645_100243824 147
39 3300026121 Ga0207683_10059417 Ga0207683_100594174 147
40 3300053093 Ga0500651_0095440 Ga0500651_0095440_1252_1818 147
41 3300053134 Ga0500658_0002847 Ga0500658_0002847_4870_5436 147
42 3300009553 Ga0105249_10555899 Ga0105249_105558991 148
43 3300013297 Ga0157378_11084423 Ga0157378_110844231 148
44 3300025961 Ga0207712_10716165 Ga0207712_107161652 148
45 3300046528 Ga0495642_0286904 Ga0495642_0286904_63_707 148
46 3300003322 rootL2_10050342 rootL2_100503423 149
47 3300013102 Ga0157371_10032318 Ga0157371_100323182 150
48 3300025302 Ga0207426_1069500 Ga0207426_10695002 150
49 3300005334 Ga0068869_101347182 Ga0068869_1013471821 151
50 3300006358 Ga0068871_100070993 Ga0068871_1000709934 151
51 3300010375 Ga0105239_10098547 Ga0105239_100985473 152
52 3300013307 Ga0157372_10138942 Ga0157372_101389422 152
53 3300013308 Ga0157375_10008085 Ga0157375_100080852 152
54 3300044901 Ga0466960_0144841 Ga0466960_0144841_302_868 152
55 3300047443 Ga0495687_001847 Ga0495687_001847_15983_16549 152
56 3300005355 Ga0070671_100004840 Ga0070671_1000048406 153
57 3300025931 Ga0207644_10003423 Ga0207644_100034233 153
58 3300013105 Ga0157369_10136934 Ga0157369_101369343 154
59 3300026067 Ga0207678_11386241 Ga0207678_113862411 154
60 3300003322 rootL2_10140137 rootL2_101401371 155
61 3300009094 Ga0111539_10122425 Ga0111539_101224251 155
62 3300013307 Ga0157372_10507597 Ga0157372_105075973 155
63 3300050493 nmdc:mga0k408_90561_c1 nmdc:mga0k408_90561_c1_115_687 155
64 3300050511 nmdc:mga08y16_306505_c1 nmdc:mga08y16_306505_c1_206_745 155
65 3300005937 Ga0081455_10408362 Ga0081455_104083621 156
66 3300025986 Ga0207658_10793602 Ga0207658_107936022 156
67 3300005330 Ga0070690_100486772 Ga0070690_1004867721 157
68 3300041406 Ga0439439_0009433 Ga0439439_0009433_1089_1631 157
69 3300041997 Ga0439431_0028564 Ga0439431_0028564_748_1290 157
70 3300042002 Ga0439442_009975 Ga0439442_009975_12_554 157
71 3300042010 Ga0439452_050191 Ga0439452_050191_394_936 157
72 3300031595 Ga0265313_10043572 Ga0265313_100435723 158
73 3300005290 Ga0065712_10092200 Ga0065712_100922002 159
74 3300005334 Ga0068869_100330351 Ga0068869_1003303512 159
75 3300005353 Ga0070669_100211945 Ga0070669_1002119452 159
76 3300005548 Ga0070665_100000002 Ga0070665_100000002613 159
77 3300013307 Ga0157372_11066096 Ga0157372_110660961 159
78 3300014326 Ga0157380_10306686 Ga0157380_103066861 159
79 3300028379 Ga0268266_10000073 Ga0268266_10000073179 159
80 3300031911 Ga0307412_10974448 Ga0307412_109744481 159
81 3300041410 Ga0439461_0021217 Ga0439461_0021217_138_680 159
82 3300041411 Ga0439466_0083004 Ga0439466_0083004_248_790 159
83 3300042156 Ga0439446_0111860 Ga0439446_0111860_236_778 159
84 3300049571 Ga0501034_0422036 Ga0501034_0422036_51_581 159
85 3300003794 Ga0055531_10000496 Ga0055531_1000049623 160
86 3300005841 Ga0068863_100261659 Ga0068863_1002616592 160
87 3300025304 Ga0209257_1000001 Ga0209257_1000001659 160
88 3300026142 Ga0207698_11363425 Ga0207698_113634251 160
89 3300028381 Ga0268264_10056789 Ga0268264_100567894 160
90 3300031548 Ga0307408_100000404 Ga0307408_10000040410 160
91 3300031911 Ga0307412_10005550 Ga0307412_100055505 160
92 3300049683 Ga0501253_070184 Ga0501253_070184_130_693 160
93 iso_pu_bacteria 2818991460 2819681659 160
94 iso_pu_bacteria 2881359912 2881363128 160
95 iso_pu_bacteria 2929177148 2929182444 160
96 iso_pu_bacteria 2929239360 2929242505 160
97 iso_pu_bacteria 2945977869 2945978369 160
98 iso_pu_bacteria 2946013367 2946015777 160
99 iso_pu_bacteria 8003151029 8003152618 160
100 3300006881 Ga0068865_100170802 Ga0068865_1001708021 161
101 3300026089 Ga0207648_10067254 Ga0207648_100672544 161
102 3300005334 Ga0068869_100109955 Ga0068869_1001099552 162
103 3300013296 Ga0157374_10000027 Ga0157374_10000027171 162
104 3300014968 Ga0157379_10300686 Ga0157379_103006863 162
105 3300014969 Ga0157376_10000368 Ga0157376_100003688 162
106 3300014969 Ga0157376_10020984 Ga0157376_100209846 162
107 3300025907 Ga0207645_10039959 Ga0207645_100399592 162
108 3300025933 Ga0207706_10453565 Ga0207706_104535652 162
109 3300026067 Ga0207678_10281211 Ga0207678_102812112 162
110 3300037418 Ga0395900_0500624 Ga0395900_0500624_509_1075 162
111 3300042007 Ga0439449_0157038 Ga0439449_0157038_181_723 162
112 3300049571 Ga0501034_0029706 Ga0501034_0029706_138_704 162
113 3300053147 Ga0500589_167135 Ga0500589_167135_11_574 162
114 3300055283 Ga0500661_012866 Ga0500661_012866_259_789 162
115 3300003320 rootH2_10042054 rootH2_100420547 163
116 3300005330 Ga0070690_100257096 Ga0070690_1002570961 163
117 3300005331 Ga0070670_100209249 Ga0070670_1002092492 163
118 3300005340 Ga0070689_100598705 Ga0070689_1005987051 163
119 3300005355 Ga0070671_100268079 Ga0070671_1002680792 163
120 3300005364 Ga0070673_100644031 Ga0070673_1006440311 163
121 3300005544 Ga0070686_100238554 Ga0070686_1002385541 163
122 3300005615 Ga0070702_100052526 Ga0070702_1000525263 163
123 3300010375 Ga0105239_10000652 Ga0105239_1000065241 163
124 3300013105 Ga0157369_10150882 Ga0157369_101508821 163
125 3300013297 Ga0157378_10667300 Ga0157378_106673001 163
126 3300025918 Ga0207662_10208782 Ga0207662_102087822 163
127 3300025931 Ga0207644_10584581 Ga0207644_105845811 163
128 3300025941 Ga0207711_11375040 Ga0207711_113750401 163
129 3300025942 Ga0207689_10016089 Ga0207689_100160894 163
130 3300026035 Ga0207703_10116387 Ga0207703_101163872 163
131 3300026075 Ga0207708_10109881 Ga0207708_101098812 163
132 3300026121 Ga0207683_10343108 Ga0207683_103431082 163
133 3300026142 Ga0207698_10042518 Ga0207698_100425183 163
134 3300044706 Ga0466964_0157427 Ga0466964_0157427_404_946 163
135 3300049513 Ga0501290_043875 Ga0501290_043875_29_592 163
136 3300003215 JGI25153J46596_10002508 JGI25153J46596_100025084 164
137 3300003316 rootH1_10008437 rootH1_100084373 164
138 3300003322 rootL2_10179155 rootL2_101791553 164
139 3300003323 rootH1_10000712 rootH1_100007121 164
140 3300003354 JGI25160J50197_1001989 JGI25160J50197_10019892 164
141 3300005535 Ga0070684_101123569 Ga0070684_1011235691 164
142 3300005616 Ga0068852_100363777 Ga0068852_1003637772 164
143 3300005616 Ga0068852_100453481 Ga0068852_1004534811 164
144 3300005843 Ga0068860_100303821 Ga0068860_1003038211 164
145 3300025297 Ga0209758_1002136 Ga0209758_100213622 164
146 3300025302 Ga0207426_1000060 Ga0207426_1000060180 164
147 3300025945 Ga0207679_11070205 Ga0207679_110702051 164
148 3300026142 Ga0207698_10998130 Ga0207698_109981302 164
149 3300038443 Ga0395901_0183336 Ga0395901_0183336_950_1516 164
150 3300039437 Ga0436365_1092683 Ga0436365_1092683_366_908 164
151 3300044658 Ga0466972_0000039 Ga0466972_0000039_134668_135231 164
152 iso_pu_bacteria 2910245624 2910248414 164

Structural Annotation

Top 5 Hits

ID Description Score Start End
3koj-assembly1.cif.gz_A crystal structure of the ssb domain of q5n255_synp6 protein from synechococcus sp. northeast structural genomics consortium target snr59a. 0.7272 75 149
1fr3-assembly1.cif.gz_A the high resolution structure of a molybdate binding protein from sporomusa ovata 0.7107 71 130
3k6o-assembly2.cif.gz_B crystal structure of protein of unknown function duf1344 (yp_001299214.1) from bacteroides vulgatus atcc 8482 at 2.00 a resolution 0.7064 74 149
4h02-assembly2.cif.gz_D crystal structure of p. falciparum lysyl-trna synthetase 0.7048 74 155
6agt-assembly2.cif.gz_C crystal structure of pfkrs complexed with chromone inhibitor 0.7044 75 155
ID Description Score Start End Superfamily
af_Q8RX36_4_128_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7581 74 151 2.40.50.140
af_P9WQM1_268_326_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.727 72 128 2.40.50.140
af_C6KT07_527_609_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7115 75 143 2.40.50.140
1fr3A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7107 71 130 2.40.50.100
af_F4HXU8_16_123_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7045 73 143 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A3C1LJM7-F1-model_v4 Uncharacterized protein 0.8947 88 164
AF-G8THZ3-F1-model_v4 Uncharacterized protein 0.8538 43 164
AF-A0A519W9Q6-F1-model_v4 Uncharacterized protein 0.8479 39 164
AF-A0A3C1LJM7-F1-model_v4 Uncharacterized protein 0.8326 88 164
AF-A0A2D6KVQ8-F1-model_v4 OB domain-containing protein 0.8096 74 149

Feature Viewer

pLDDT pTM Quality
76.55 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map