F212914

General Info

Members Datasets Scaffolds Average Seq Length
151 91 290 473

Family's Representative Sequence

Representative Sequence 3300053178|Ga0500637_0030807|Ga0500637_0030807_708_2243
Length 511
Sequence LLTCSIVAFRLEVLLHHFVRKERDQDTMGNQIPLERVDDNRWRIPMRYNAEMRVPGMVYADDELIELMKEDNALQQVVNVASLPGIVGHSLAMPDIHWGYGFPVGGVAATDAEQGVISPGGIGFDINCGVRLLATELLQDQVKGQVDKLADELFANLPSGVGTDGMRKLSASEMHEVMVRGAAWAVEEGYGVPADLDVTEENGCLTGAKPEAVSQKAIQRGISQLGSLGSGNHFCEIQVVEHIYDMEAAKALGIGQKGQVVTTIHCGSRGFGHQVAEDFIKLAESKQQDYGFKLVDRQLACLPLQSTEGQQYLGAMACAANFAWANRQLLMHGVRQAFSTVFGRKARAKDLPMVYDVCHNIAKIEEYEIDGQALKVCVHRKGATRAFPAGHPAIPEQYRAIGQPVLIPGDMGRYSFVLVGAQGSMEQSFGTCCHGAGRRLSRTAAKKAMDSKNLLKYLDRQGVTVRVHSKNLLAEEAPAAYKDAQQVVNVVHNAGLATLVARLKPIVVVKG

Samples

Sample ID Description Type Environment
1 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
30 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
41 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
42 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
43 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
44 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
48 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
49 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
50 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
51 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
52 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
53 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
57 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
58 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
59 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
60 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
61 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
74 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
75 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
76 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
77 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
78 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
79 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
80 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
81 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
82 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
86 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
87 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
88 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
89 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
90 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
91 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 1.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 0
Rhizosphere 97.35
Stem 0
Stem Tuber 0
Unclassified 7.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500637_0030807 3300053178 Bacteria 2988
2 rootH1_10283269 3300003323 Bacteria 2759
3 Ga0070691_10008495 3300005341 Bacteria 4701
4 Ga0070692_10005408 3300005345 Bacteria 5444
5 Ga0070669_100146173 3300005353 Bacteria 1827
6 Ga0070708_100016898 3300005445 Bacteria 6068
7 Ga0070708_100017985 3300005445 Bacteria 5910
8 Ga0070708_100193060 3300005445 Bacteria 1905
9 Ga0070706_100003350 3300005467 Bacteria 15807
10 Ga0070706_100017906 3300005467 Bacteria 6536
11 Ga0070706_100048537 3300005467 Unclassified 3918
12 Ga0070706_100068707 3300005467 Bacteria 3277
13 Ga0070707_100000028 3300005468 Archaea 123368
14 Ga0070707_100018446 3300005468 Bacteria 6564
15 Ga0070707_100030497 3300005468 Unclassified 5134
16 Ga0070707_100033072 3300005468 Bacteria 4930
17 Ga0070707_100207664 3300005468 Bacteria 1909
18 Ga0070698_100055953 3300005471 Unclassified 3998
19 Ga0070698_100072709 3300005471 Bacteria 3446
20 Ga0070698_100079954 3300005471 Bacteria 3265
21 Ga0070699_100028708 3300005518 Bacteria 4797
22 Ga0070699_100065338 3300005518 Bacteria 3157
23 Ga0070699_100099335 3300005518 Unclassified 2550
24 Ga0070679_100036605 3300005530 Bacteria 4871
25 Ga0070679_100171943 3300005530 Bacteria 2139
26 Ga0070697_100021510 3300005536 Bacteria 5111
27 Ga0070697_100028655 3300005536 Unclassified 4460
28 Ga0070697_100049631 3300005536 Archaea 3406
29 Ga0070704_100016951 3300005549 Bacteria 4619
30 Ga0068857_100003657 3300005577 Bacteria 12889
31 Ga0068859_100116504 3300005617 Bacteria 2736
32 Ga0081455_10035615 3300005937 Bacteria 4445
33 Ga0081538_10012653 3300005981 Bacteria 6750
34 Ga0081539_10000092 3300005985 Bacteria 208968
35 Ga0070717_10004306 3300006028 Bacteria 10266
36 Ga0075428_100042889 3300006844 Bacteria 4974
37 Ga0075428_100049231 3300006844 Bacteria 4624
38 Ga0075428_100102122 3300006844 Bacteria 3127
39 Ga0075430_100079046 3300006846 Bacteria 2757
40 Ga0075431_100156330 3300006847 Bacteria 2346
41 Ga0075431_100202984 3300006847 Bacteria 2028
42 Ga0075431_100245685 3300006847 Unclassified 1819
43 Ga0075436_100140883 3300006914 Archaea 1695
44 Ga0097620_100116504 3300006931 Bacteria 2736
45 Ga0099794_10002914 3300007265 Bacteria 6433
46 Ga0099794_10034216 3300007265 Unclassified 2392
47 Ga0111539_10012438 3300009094 Bacteria 10669
48 Ga0111539_10043336 3300009094 Bacteria 5395
49 Ga0114129_10000026 3300009147 Bacteria 113517
50 Ga0114129_10005955 3300009147 Bacteria 17263
51 Ga0114129_10037832 3300009147 Bacteria 6810
52 Ga0114129_10062569 3300009147 Bacteria 5198
53 Ga0206356_10857101 3300020070 Bacteria 2250
54 Ga0213876_10025746 3300021384 Bacteria 3102
55 Ga0224712_10012051 3300022467 Archaea 2705
56 Ga0207653_10013595 3300025885 Bacteria 2550
57 Ga0207684_10001497 3300025910 Bacteria 25099
58 Ga0207684_10004060 3300025910 Bacteria 13977
59 Ga0207684_10008410 3300025910 Bacteria 9176
60 Ga0207684_10039824 3300025910 Bacteria 3984
61 Ga0207684_10145202 3300025910 Bacteria 2041
62 Ga0207684_10157676 3300025910 Unclassified 1954
63 Ga0207652_10127500 3300025921 Bacteria 2267
64 Ga0207646_10000001 3300025922 Bacteria 1242027
65 Ga0207646_10007400 3300025922 Bacteria 11168
66 Ga0207646_10013499 3300025922 Bacteria 7809
67 Ga0207646_10015373 3300025922 Bacteria 7230
68 Ga0207646_10046831 3300025922 Unclassified 3880
69 Ga0207646_10048780 3300025922 Bacteria 3794
70 Ga0207646_10097042 3300025922 Bacteria 2640
71 Ga0207681_10132801 3300025923 Bacteria 1843
72 Ga0207674_10090714 3300026116 Bacteria 3047
73 Ga0209588_1000096 3300027671 Bacteria 27638
74 Ga0265338_10001058 3300028800 Bacteria 45770
75 Ga0265338_10055006 3300028800 Bacteria 3544
76 Ga0307408_100049412 3300031548 Bacteria 3021
77 Ga0316575_10004804 3300031665 Bacteria 4773
78 Ga0316579_10052324 3300031691 Bacteria 1912
79 Ga0316579_10068093 3300031691 Bacteria 1683
80 Ga0316576_10037113 3300031727 Bacteria 3486
81 Ga0316577_10029299 3300031733 Bacteria 3072
82 Ga0307406_10045659 3300031901 Bacteria 2752
83 Ga0307407_10050077 3300031903 Bacteria 2388
84 Ga0307409_100241068 3300031995 Bacteria 1646
85 Ga0373956_0000598 3300035119 Bacteria 14783
86 Ga0373955_0059656 3300035172 Bacteria 2102
87 Ga0373927_0000216 3300035695 Bacteria 45961
88 Ga0373933_0007495 3300035724 Bacteria 5959
89 Ga0316584_0077579 3300036712 Bacteria 2489
90 Ga0436365_1250240 3300039437 Bacteria 4362
91 Ga0451577_0039399 3300042876 Bacteria 4246
92 Ga0451577_0068407 3300042876 Bacteria 3167
93 Ga0466969_0001236 3300044656 Bacteria 13809
94 Ga0466972_0011206 3300044658 Bacteria 4500
95 Ga0466965_0024149 3300044683 Bacteria 2939
96 Ga0466966_0008715 3300044684 Bacteria 6714
97 Ga0466961_0101180 3300044693 Bacteria 1815
98 Ga0466964_0000726 3300044706 Bacteria 10692
99 Ga0453684_0000184 3300044712 Bacteria 274619
100 Ga0466968_0000376 3300044735 Bacteria 14605
101 Ga0466970_0001689 3300044765 Bacteria 10612
102 Ga0466957_0048742 3300044842 Bacteria 2574
103 Ga0466959_0007987 3300045049 Bacteria 7452
104 Ga0466959_0036444 3300045049 Unclassified 3634
105 Ga0466959_0057889 3300045049 Bacteria 2824
106 Ga0451576_0000785 3300045051 Bacteria 62394
107 Ga0495628_0061150 3300046516 Bacteria 2954
108 Ga0495630_0017706 3300046517 Bacteria 5223
109 Ga0501037_0003916 3300049573 Bacteria 10800
110 Ga0501038_0001890 3300049574 Bacteria 19374
111 Ga0501039_0148738 3300049575 Bacteria 1840
112 Ga0501041_0008406 3300049577 Bacteria 6070
113 Ga0501048_0036082 3300049582 Bacteria 3555
114 Ga0501067_0028449 3300049583 Bacteria 3096
115 Ga0501068_0014096 3300049584 Bacteria 4564
116 Ga0501068_0105495 3300049584 Bacteria 1749
117 Ga0501071_0034985 3300049587 Bacteria 3577
118 Ga0501075_0000010 3300049591 Bacteria 87481
119 Ga0501075_0004490 3300049591 Bacteria 9450
120 Ga0501076_0000027 3300049592 Bacteria 78077
121 Ga0501076_0003486 3300049592 Bacteria 11051
122 Ga0501076_0116516 3300049592 Bacteria 2162
123 Ga0501077_0079154 3300049593 Bacteria 2082
124 Ga0501077_0132133 3300049593 Bacteria 1583
125 Ga0501079_0007132 3300049741 Bacteria 8434
126 Ga0501079_0095725 3300049741 Bacteria 2301
127 Ga0501080_0074862 3300049742 Bacteria 3150
128 Ga0501080_0135382 3300049742 Bacteria 2280
129 Ga0501081_0015966 3300049743 Bacteria 4959
130 Ga0501035_0129698 3300049822 Bacteria 2199
131 Ga0501044_0007250 3300049823 Bacteria 12191
132 nmdc:mga05p37_113090_c1 3300050507 Unclassified 3338
133 nmdc:mga05p37_13734_c1 3300050507 Bacteria 9703
134 nmdc:mga05p37_4910_c1 3300050507 Bacteria 15658
135 nmdc:mga05p37_94497_c1 3300050507 Bacteria 3683
136 nmdc:mga09592_254398_c1 3300050508 Bacteria 1522
137 nmdc:mga0qj67_39769_c1 3300050509 Bacteria 3694
138 nmdc:mga08y16_172004_c1 3300050511 Bacteria 2250
139 nmdc:mga08y16_254000_c1 3300050511 Bacteria 1816
140 nmdc:mga08y16_74861_c1 3300050511 Bacteria 3529
141 nmdc:mga0n895_169625_c1 3300050512 Archaea 2214
142 Ga0495612_0009080 3300053078 Bacteria 4032
143 Ga0501082_0000780 3300060353 Bacteria 27961
144 Ga0530510_0000010 3300061734 Bacteria 155647
145 Ga0530510_0008414 3300061734 Bacteria 7191
146 Ga0500637_0030807
147 rootH1_10283269
148 Ga0070691_10008495
149 Ga0070692_10005408
150 Ga0070669_100146173
151 Ga0070708_100016898
152 Ga0070708_100017985
153 Ga0070708_100193060
154 Ga0070706_100003350
155 Ga0070706_100017906
156 Ga0070706_100048537
157 Ga0070706_100068707
158 Ga0070707_100000028
159 Ga0070707_100018446
160 Ga0070707_100030497
161 Ga0070707_100033072
162 Ga0070707_100207664
163 Ga0070698_100055953
164 Ga0070698_100072709
165 Ga0070698_100079954
166 Ga0070699_100028708
167 Ga0070699_100065338
168 Ga0070699_100099335
169 Ga0070679_100036605
170 Ga0070679_100171943
171 Ga0070697_100021510
172 Ga0070697_100028655
173 Ga0070697_100049631
174 Ga0070704_100016951
175 Ga0068857_100003657
176 Ga0068859_100116504
177 Ga0081455_10035615
178 Ga0081538_10012653
179 Ga0081539_10000092
180 Ga0070717_10004306
181 Ga0075428_100042889
182 Ga0075428_100049231
183 Ga0075428_100102122
184 Ga0075430_100079046
185 Ga0075431_100156330
186 Ga0075431_100202984
187 Ga0075431_100245685
188 Ga0075436_100140883
189 Ga0097620_100116504
190 Ga0099794_10002914
191 Ga0099794_10034216
192 Ga0111539_10012438
193 Ga0111539_10043336
194 Ga0114129_10000026
195 Ga0114129_10005955
196 Ga0114129_10037832
197 Ga0114129_10062569
198 Ga0206356_10857101
199 Ga0213876_10025746
200 Ga0224712_10012051
201 Ga0207653_10013595
202 Ga0207684_10001497
203 Ga0207684_10004060
204 Ga0207684_10008410
205 Ga0207684_10039824
206 Ga0207684_10145202
207 Ga0207684_10157676
208 Ga0207652_10127500
209 Ga0207646_10000001
210 Ga0207646_10007400
211 Ga0207646_10013499
212 Ga0207646_10015373
213 Ga0207646_10046831
214 Ga0207646_10048780
215 Ga0207646_10097042
216 Ga0207681_10132801
217 Ga0207674_10090714
218 Ga0209588_1000096
219 Ga0265338_10001058
220 Ga0265338_10055006
221 Ga0307408_100049412
222 Ga0316575_10004804
223 Ga0316579_10052324
224 Ga0316579_10068093
225 Ga0316576_10037113
226 Ga0316577_10029299
227 Ga0307406_10045659
228 Ga0307407_10050077
229 Ga0307409_100241068
230 Ga0373956_0000598
231 Ga0373955_0059656
232 Ga0373927_0000216
233 Ga0373933_0007495
234 Ga0316584_0077579
235 Ga0436365_1250240
236 Ga0451577_0039399
237 Ga0451577_0068407
238 Ga0466969_0001236
239 Ga0466972_0011206
240 Ga0466965_0024149
241 Ga0466966_0008715
242 Ga0466961_0101180
243 Ga0466964_0000726
244 Ga0453684_0000184
245 Ga0466968_0000376
246 Ga0466970_0001689
247 Ga0466957_0048742
248 Ga0466959_0007987
249 Ga0466959_0036444
250 Ga0466959_0057889
251 Ga0451576_0000785
252 Ga0495628_0061150
253 Ga0495630_0017706
254 Ga0501037_0003916
255 Ga0501038_0001890
256 Ga0501039_0148738
257 Ga0501041_0008406
258 Ga0501048_0036082
259 Ga0501067_0028449
260 Ga0501068_0014096
261 Ga0501068_0105495
262 Ga0501071_0034985
263 Ga0501075_0000010
264 Ga0501075_0004490
265 Ga0501076_0000027
266 Ga0501076_0003486
267 Ga0501076_0116516
268 Ga0501077_0079154
269 Ga0501077_0132133
270 Ga0501079_0007132
271 Ga0501079_0095725
272 Ga0501080_0074862
273 Ga0501080_0135382
274 Ga0501081_0015966
275 Ga0501035_0129698
276 Ga0501044_0007250
277 nmdc:mga05p37_113090_c1
278 nmdc:mga05p37_13734_c1
279 nmdc:mga05p37_4910_c1
280 nmdc:mga05p37_94497_c1
281 nmdc:mga09592_254398_c1
282 nmdc:mga0qj67_39769_c1
283 nmdc:mga08y16_172004_c1
284 nmdc:mga08y16_254000_c1
285 nmdc:mga08y16_74861_c1
286 nmdc:mga0n895_169625_c1
287 Ga0495612_0009080
288 Ga0501082_0000780
289 Ga0530510_0000010
290 Ga0530510_0008414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01139

RtcB

tRNA-splicing ligase RtcB

76

511

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dcb-assembly2.cif.gz_B rna ligase rtcb from pyrococcus horikoshii in complex with ni2+ and gtp 0.981 6 485
4dwr-assembly3.cif.gz_C rna ligase rtcb/mn2+ complex 0.978 6 485
8dcb-assembly2.cif.gz_B rna ligase rtcb from pyrococcus horikoshii in complex with ni2+ and gtp 0.9749 6 485
7p3b-assembly2.cif.gz_B human rna ligase rtcb in complex with gmp and co(ii) 0.9715 8 485
4dwr-assembly3.cif.gz_C rna ligase rtcb/mn2+ complex 0.964 6 485
ID Description Score Start End Superfamily
af_Q99LF4_9_505_3.90.1860.10 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.9795 8 485 3.90.1860.10
af_Q58095_565_968_3.90.1860.10 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.9741 101 485 3.90.1860.10
1uc2A00 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.9691 6 485 3.90.1860.10
1uc2A00 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.9651 6 485 3.90.1860.10
af_Q99LF4_9_505_3.90.1860.10 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.9635 8 485 3.90.1860.10
ID Description Score Start End GO Terms
AF-A0A497BMV5-F1-model_v4 3'-phosphate/5'-hydroxy nucleic acid ligase (EC 6.5.1.8) 0.9994 7 85 GO:0003972
GO:0005525
GO:0006396
GO:0042245
GO:0046872
GO:0170057
AF-A0A455SID2-F1-model_v4 tRNA-splicing ligase RtcB (EC 6.5.1.-) 0.9986 4 485 GO:0003972
GO:0005525
GO:0006396
GO:0042245
GO:0046872
GO:0170057
AF-A0A455SID2-F1-model_v4 tRNA-splicing ligase RtcB (EC 6.5.1.-) 0.9965 4 485 GO:0003972
GO:0005525
GO:0006396
GO:0042245
GO:0046872
GO:0170057
AF-A0A2M8CD48-F1-model_v4 3'-phosphate/5'-hydroxy nucleic acid ligase (EC 6.5.1.8) 0.9964 7 102 GO:0003972
GO:0004519
GO:0005525
GO:0006396
GO:0016539
GO:0042245
GO:0046872
GO:0170057
AF-A0A7C2GMJ2-F1-model_v4 3'-phosphate/5'-hydroxy nucleic acid ligase (EC 6.5.1.8) 0.9943 7 292 GO:0003972
GO:0005525
GO:0006396
GO:0042245
GO:0046872
GO:0170057

Map