F212795

General Info

Members Datasets Scaffolds Average Seq Length
151 108 302 242

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0308493|Ga0501079_0308493_15_917
Length 288
Sequence MWSDGCTSMKSTAQRIRAGIVCTAMTSTLPDSDRRWHAPTPGCRGTTVVAVAQAIKVGVLGGRGRVGSEVCRAVEAADDTDLVAVVDVDDELDALVTSGAEVVVDFTHPDAVMDNLEFCIDHGIHAVVGTTGFDDDRLATVRGWLESAPKIGVLIAPNFAIGAILMMRFASIAAPFYESVEVVELHHPDKADAPSGTARRTAELIAAARRDAGCPPVPDATSSGLEGARGADVDVAHQEVILGAPGETLTIRHDSLDRVSFMEGVLLGVRTIGSRPGLTVGLENFMDS

Samples

Sample ID Description Type Environment
1 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
10 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
40 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
46 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
47 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
48 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
49 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
50 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
51 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
52 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
57 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
58 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
59 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
60 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
61 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
62 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
65 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
69 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
80 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
83 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
84 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
87 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
88 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
89 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
90 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
91 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
92 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
93 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
94 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
95 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
96 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
97 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
98 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
99 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
100 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
101 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
102 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
103 2867475112 Streptomyces sp. TM32 Isolate Unclassified
104 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
105 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
106 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
107 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
108 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.72
Metatranscriptomes 1.32
Isolates 5.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.87
Nodule 0
Rhizoplane 2.65
Rhizosphere 71.52
Stem 0
Stem Tuber 0
Unclassified 1.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501079_0308493 3300049741 Bacteria 1238
2 JGI25406J46586_10000187 3300003203 Bacteria 27680
3 Ga0070683_100356402 3300005329 Bacteria 1393
4 Ga0070692_10310574 3300005345 Unclassified 966
5 Ga0070714_100002323 3300005435 Bacteria 13976
6 Ga0070714_100019368 3300005435 Bacteria 5542
7 Ga0070713_100174077 3300005436 Bacteria 1930
8 Ga0070663_100339624 3300005455 Bacteria 1213
9 Ga0070662_100052901 3300005457 Unclassified 2938
10 Ga0070672_100468484 3300005543 Bacteria 1087
11 Ga0068861_100144828 3300005719 Bacteria 1943
12 Ga0081455_10013825 3300005937 Bacteria 7944
13 Ga0081455_10017830 3300005937 Bacteria 6788
14 Ga0081538_10091035 3300005981 Bacteria 1576
15 Ga0081539_10000102 3300005985 Bacteria 198297
16 Ga0070717_10171488 3300006028 Bacteria 1887
17 Ga0075365_10002131 3300006038 Bacteria 9494
18 Ga0075365_10014097 3300006038 Bacteria 4802
19 Ga0075365_10098086 3300006038 Bacteria 2004
20 Ga0075365_10125413 3300006038 Bacteria 1774
21 Ga0075365_10219000 3300006038 Bacteria 1335
22 Ga0075365_10239419 3300006038 Bacteria 1274
23 Ga0075363_100008491 3300006048 Bacteria 4786
24 Ga0075364_10028558 3300006051 Bacteria 3571
25 Ga0075432_10001391 3300006058 Bacteria 7860
26 Ga0075362_10014553 3300006177 Bacteria 3177
27 Ga0075367_10019990 3300006178 Bacteria 3723
28 Ga0075370_10074063 3300006353 Bacteria 1951
29 Ga0075428_100007258 3300006844 Bacteria 12280
30 Ga0075430_100042737 3300006846 Bacteria 3832
31 Ga0075431_100014771 3300006847 Bacteria 7906
32 Ga0075433_10003345 3300006852 Bacteria 12394
33 Ga0075434_100005426 3300006871 Bacteria 11610
34 Ga0075429_100008038 3300006880 Bacteria 9167
35 Ga0075429_100293625 3300006880 Bacteria 1423
36 Ga0075435_100004514 3300007076 Bacteria 9570
37 Ga0105245_10426028 3300009098 Bacteria 1331
38 Ga0213876_10005642 3300021384 Bacteria 6872
39 Ga0207426_1009090 3300025302 Bacteria 3953
40 Ga0207684_10009089 3300025910 Bacteria 8799
41 Ga0207687_10296890 3300025927 Bacteria 1300
42 Ga0207700_10100646 3300025928 Bacteria 2304
43 Ga0207664_10005013 3300025929 Bacteria 9004
44 Ga0207706_10086387 3300025933 Unclassified 2757
45 Ga0207641_10853520 3300026088 Bacteria 903
46 Ga0207675_100007176 3300026118 Bacteria 10530
47 Ga0207675_100181137 3300026118 Bacteria 2017
48 Ga0209813_10004178 3300027866 Bacteria 3430
49 Ga0207428_10008566 3300027907 Bacteria 9229
50 Ga0265338_10255728 3300028800 Bacteria 1290
51 Ga0307408_100210745 3300031548 Bacteria 1579
52 Ga0307406_10055827 3300031901 Bacteria 2526
53 Ga0307416_100022657 3300032002 Bacteria 4539
54 Ga0307411_10223743 3300032005 Bacteria 1462
55 Ga0307415_100024787 3300032126 Bacteria 3753
56 Ga0307415_100061849 3300032126 Bacteria 2594
57 Ga0307507_10000001 3300033179 Bacteria 417520
58 Ga0395900_0073632 3300037418 Bacteria 3512
59 Ga0436365_0773918 3300039437 Bacteria 51915
60 Ga0436362_0058480 3300039453 Bacteria 2585
61 Ga0466969_0030154 3300044656 Bacteria 2765
62 Ga0466965_0047811 3300044683 Bacteria 2118
63 Ga0466966_0004614 3300044684 Bacteria 9076
64 Ga0466961_0011034 3300044693 Bacteria 5775
65 Ga0466961_0059106 3300044693 Bacteria 2438
66 Ga0466961_0391892 3300044693 Bacteria 843
67 Ga0466963_0008619 3300044694 Bacteria 6122
68 Ga0466963_0163700 3300044694 Bacteria 1549
69 Ga0466963_0360850 3300044694 Bacteria 1023
70 Ga0466971_0148238 3300044719 Bacteria 1094
71 Ga0466968_0027115 3300044735 Bacteria 2356
72 Ga0466970_0003971 3300044765 Bacteria 7256
73 Ga0466970_0069238 3300044765 Bacteria 1896
74 Ga0466970_0093603 3300044765 Bacteria 1633
75 Ga0466957_0030743 3300044842 Bacteria 3207
76 Ga0466957_0049652 3300044842 Bacteria 2551
77 Ga0466957_0060195 3300044842 Bacteria 2328
78 Ga0466957_0087842 3300044842 Bacteria 1944
79 Ga0466957_0177497 3300044842 Bacteria 1390
80 Ga0466960_0009689 3300044901 Bacteria 3981
81 Ga0466960_0094658 3300044901 Bacteria 1528
82 Ga0466959_0025955 3300045049 Bacteria 4345
83 Ga0466958_0213444 3300045836 Bacteria 1230
84 Ga0466967_0001734 3300045976 Bacteria 13007
85 Ga0466967_0039213 3300045976 Bacteria 4070
86 Ga0466967_0060915 3300045976 Bacteria 3346
87 Ga0466967_0193108 3300045976 Bacteria 1925
88 Ga0466967_0306788 3300045976 Bacteria 1528
89 Ga0466967_0347297 3300045976 Bacteria 1435
90 Ga0466967_0433428 3300045976 Bacteria 1283
91 Ga0495629_0040833 3300046459 Bacteria 3264
92 Ga0495613_0286062 3300046689 Bacteria 1144
93 Ga0496102_0392983 3300048905 Bacteria 1304
94 Ga0496102_0396139 3300048905 Bacteria 1298
95 Ga0496105_0500422 3300048908 Bacteria 954
96 Ga0496110_0150381 3300048913 Bacteria 2108
97 Ga0501317_010428 3300049533 Bacteria 1110
98 Ga0501318_010616 3300049534 Bacteria 1025
99 Ga0501032_0009882 3300049569 Bacteria 6894
100 Ga0501034_0264016 3300049571 Bacteria 1664
101 Ga0501038_0141561 3300049574 Bacteria 1967
102 Ga0501039_0021130 3300049575 Bacteria 4993
103 Ga0501039_0116667 3300049575 Bacteria 2090
104 Ga0501039_0267794 3300049575 Bacteria 1343
105 Ga0501040_0268150 3300049576 Bacteria 1219
106 Ga0501042_0351723 3300049578 Bacteria 1066
107 Ga0501043_0633472 3300049579 Bacteria 787
108 Ga0501047_0227594 3300049581 Bacteria 1719
109 Ga0501067_0030463 3300049583 Bacteria 2992
110 Ga0501069_0002678 3300049585 Bacteria 9094
111 Ga0501070_0005655 3300049586 Bacteria 10657
112 Ga0501070_0020574 3300049586 Bacteria 5534
113 Ga0501071_0089957 3300049587 Bacteria 2254
114 Ga0501071_0341279 3300049587 Bacteria 1139
115 Ga0501072_0198192 3300049588 Bacteria 1601
116 Ga0501035_0202021 3300049822 Bacteria 1704
117 Ga0501044_0050482 3300049823 Bacteria 4292
118 Ga0501045_0034542 3300049824 Bacteria 3670
119 Ga0501045_0058681 3300049824 Bacteria 2818
120 Ga0501045_0331635 3300049824 Bacteria 1132
121 nmdc:mga03n38_36840_c1 3300050490 Bacteria 2106
122 nmdc:mga00v17_280630_c1 3300050491 Bacteria 1081
123 nmdc:mga00v17_32072_c1 3300050491 Bacteria 3104
124 nmdc:mga0yw44_108760_c1 3300050492 Bacteria 1774
125 nmdc:mga0yw44_188976_c1 3300050492 Bacteria 1358
126 nmdc:mga0yw44_47185_c2 3300050492 Bacteria 1751
127 nmdc:mga0yw44_65694_c1 3300050492 Bacteria 2237
128 nmdc:mga0yw44_74850_c1 3300050492 Bacteria 2110
129 nmdc:mga06z11_124819_c1 3300050494 Bacteria 1440
130 nmdc:mga06z11_13496_c1 3300050494 Bacteria 3590
131 nmdc:mga04h51_7950_c1 3300050495 Bacteria 2822
132 nmdc:mga07m45_28376_c1 3300050496 Bacteria 3089
133 nmdc:mga07m45_95179_c1 3300050496 Bacteria 1708
134 Ga0495601_0153375 3300053077 Bacteria 1504
135 Ga0500641_0003969 3300053096 Bacteria 5232
136 Ga0500556_0002486 3300053104 Bacteria 5887
137 Ga0500620_007033 3300053155 Bacteria 2749
138 Ga0500637_0142504 3300053178 Bacteria 1387
139 Ga0466962_0197890 3300061719 Bacteria 981
140 Ga0530510_0120244 3300061734 Bacteria 1928
141 Ga0530510_0152102 3300061734 Bacteria 1709
142 Ga0530510_0316908 3300061734 Bacteria 1169
143 2586062849 2585427649 Bacteria 9053857
144 2809587975 2808606522 Bacteria 9488490
145 2816425327 2816332119 Bacteria 8120218
146 2867480935 2867475112 Bacteria 6909112
147 2899367240 2899359706 Bacteria 10940472
148 2915774600 2915768154 Bacteria 8424322
149 2997456016 2997451912 Bacteria 8492419
150 3006426453 3006425503 Bacteria 6491253
151 8054163196 8054160619 Bacteria 7783213
152 Ga0501079_0308493
153 JGI25406J46586_10000187
154 Ga0070683_100356402
155 Ga0070692_10310574
156 Ga0070714_100002323
157 Ga0070714_100019368
158 Ga0070713_100174077
159 Ga0070663_100339624
160 Ga0070662_100052901
161 Ga0070672_100468484
162 Ga0068861_100144828
163 Ga0081455_10013825
164 Ga0081455_10017830
165 Ga0081538_10091035
166 Ga0081539_10000102
167 Ga0070717_10171488
168 Ga0075365_10002131
169 Ga0075365_10014097
170 Ga0075365_10098086
171 Ga0075365_10125413
172 Ga0075365_10219000
173 Ga0075365_10239419
174 Ga0075363_100008491
175 Ga0075364_10028558
176 Ga0075432_10001391
177 Ga0075362_10014553
178 Ga0075367_10019990
179 Ga0075370_10074063
180 Ga0075428_100007258
181 Ga0075430_100042737
182 Ga0075431_100014771
183 Ga0075433_10003345
184 Ga0075434_100005426
185 Ga0075429_100008038
186 Ga0075429_100293625
187 Ga0075435_100004514
188 Ga0105245_10426028
189 Ga0213876_10005642
190 Ga0207426_1009090
191 Ga0207684_10009089
192 Ga0207687_10296890
193 Ga0207700_10100646
194 Ga0207664_10005013
195 Ga0207706_10086387
196 Ga0207641_10853520
197 Ga0207675_100007176
198 Ga0207675_100181137
199 Ga0209813_10004178
200 Ga0207428_10008566
201 Ga0265338_10255728
202 Ga0307408_100210745
203 Ga0307406_10055827
204 Ga0307416_100022657
205 Ga0307411_10223743
206 Ga0307415_100024787
207 Ga0307415_100061849
208 Ga0307507_10000001
209 Ga0395900_0073632
210 Ga0436365_0773918
211 Ga0436362_0058480
212 Ga0466969_0030154
213 Ga0466965_0047811
214 Ga0466966_0004614
215 Ga0466961_0011034
216 Ga0466961_0059106
217 Ga0466961_0391892
218 Ga0466963_0008619
219 Ga0466963_0163700
220 Ga0466963_0360850
221 Ga0466971_0148238
222 Ga0466968_0027115
223 Ga0466970_0003971
224 Ga0466970_0069238
225 Ga0466970_0093603
226 Ga0466957_0030743
227 Ga0466957_0049652
228 Ga0466957_0060195
229 Ga0466957_0087842
230 Ga0466957_0177497
231 Ga0466960_0009689
232 Ga0466960_0094658
233 Ga0466959_0025955
234 Ga0466958_0213444
235 Ga0466967_0001734
236 Ga0466967_0039213
237 Ga0466967_0060915
238 Ga0466967_0193108
239 Ga0466967_0306788
240 Ga0466967_0347297
241 Ga0466967_0433428
242 Ga0495629_0040833
243 Ga0495613_0286062
244 Ga0496102_0392983
245 Ga0496102_0396139
246 Ga0496105_0500422
247 Ga0496110_0150381
248 Ga0501317_010428
249 Ga0501318_010616
250 Ga0501032_0009882
251 Ga0501034_0264016
252 Ga0501038_0141561
253 Ga0501039_0021130
254 Ga0501039_0116667
255 Ga0501039_0267794
256 Ga0501040_0268150
257 Ga0501042_0351723
258 Ga0501043_0633472
259 Ga0501047_0227594
260 Ga0501067_0030463
261 Ga0501069_0002678
262 Ga0501070_0005655
263 Ga0501070_0020574
264 Ga0501071_0089957
265 Ga0501071_0341279
266 Ga0501072_0198192
267 Ga0501035_0202021
268 Ga0501044_0050482
269 Ga0501045_0034542
270 Ga0501045_0058681
271 Ga0501045_0331635
272 nmdc:mga03n38_36840_c1
273 nmdc:mga00v17_280630_c1
274 nmdc:mga00v17_32072_c1
275 nmdc:mga0yw44_108760_c1
276 nmdc:mga0yw44_188976_c1
277 nmdc:mga0yw44_47185_c2
278 nmdc:mga0yw44_65694_c1
279 nmdc:mga0yw44_74850_c1
280 nmdc:mga06z11_124819_c1
281 nmdc:mga06z11_13496_c1
282 nmdc:mga04h51_7950_c1
283 nmdc:mga07m45_28376_c1
284 nmdc:mga07m45_95179_c1
285 Ga0495601_0153375
286 Ga0500641_0003969
287 Ga0500556_0002486
288 Ga0500620_007033
289 Ga0500637_0142504
290 Ga0466962_0197890
291 Ga0530510_0120244
292 Ga0530510_0152102
293 Ga0530510_0316908
294 2586062849
295 2809587975
296 2816425327
297 2867480935
298 2899367240
299 2915774600
300 2997456016
301 3006426453
302 8054163196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01113

DapB_N

Dihydrodipicolinate reductase, N-terminus

55

159

0.94

PF05173

DapB_C

Dihydrodipicolinate reductase, C-terminus

162

286

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c3v-assembly1.cif.gz_A dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc 0.9551 5 249
1c3v-assembly1.cif.gz_A dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc 0.9438 5 249
5wol-assembly1.cif.gz_A crystal structure of dihydrodipicolinate reductase dapb from coxiella burnetii 0.9322 4 247
5wol-assembly1.cif.gz_A crystal structure of dihydrodipicolinate reductase dapb from coxiella burnetii 0.9245 4 247
1yl5-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form a) 0.8999 2 249
ID Description Score Start End Superfamily
af_P9WP23_2_88_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9934 5 89 3.40.50.720
af_P9WP23_2_120_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9918 5 122 3.50.50.60
1yl7C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9828 5 249 3.40.50.720
af_P9WP23_2_120_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9754 5 122 3.50.50.60
1c3vA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9663 109 217 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A6I3D5I3-F1-model_v4 deleted 0.9937 3 80
AF-A0A7V9BXP0-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase 0.9881 2 104 GO:0005829
GO:0008839
GO:0009089
GO:0019877
AF-A0A2T0TA40-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) (EC 1.17.1.8) 0.9863 2 249 GO:0005829
GO:0008839
GO:0009089
GO:0016726
GO:0019877
GO:0050661
GO:0051287
AF-X8FAC5-F1-model_v4 deleted 0.9859 5 111
AF-A0A1X4I634-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase 0.985 1 94 GO:0005829
GO:0008839
GO:0009089
GO:0019877

Map