F212657

General Info

Members Datasets Scaffolds Average Seq Length
151 118 114 165

Family's Representative Sequence

Representative Sequence 3300048926|Ga0496123_0049175|Ga0496123_0049175_1665_2186
Length 165
Sequence MTDESASLDPVELGAYFALIEVSSLLRHAVELQLKKAGGLSYVQFQLLATLGDAPAGSMRMTDLADGVVYSRSGLTHQAVTRAPSVDDERSVTVTITEAGRAVLAKVFPGHIAVLKKMFFAPLERADVEELARSLSAVRDHMRATPPRSAAPRRRGGRSSRAGDS

Samples

Sample ID Description Type Environment
1 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
2 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
3 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
4 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
5 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
6 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
7 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
8 2808606372 Agromyces sp. 23-23 Isolate Unclassified
9 2808606394 Promicromonospora sp. C35 Isolate Unclassified
10 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
11 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
12 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
13 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
14 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
15 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
16 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
17 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
18 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
19 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
20 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
21 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
22 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
23 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
24 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
25 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
26 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
27 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
28 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
29 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
30 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
31 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
32 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
33 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
34 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
35 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
36 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
39 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
40 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
64 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
72 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
73 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
89 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
90 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
91 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
92 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
93 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
112 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
113 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
114 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
115 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
116 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
117 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
118 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.5
Metatranscriptomes 0
Isolates 24.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 15.89
Nodule 0
Rhizoplane 3.97
Rhizosphere 47.02
Stem 0
Stem Tuber 0.66
Unclassified 31.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1006719 3300002737 Bacteria 1925
2 JGI25164J39214_1000385 3300002772 Bacteria 26010
3 JGI25165J46597_1000014 3300003214 Bacteria 390383
4 Ga0055539_1000006 3300003752 Bacteria 580055
5 Ga0055533_1000002 3300003756 Bacteria 1196393
6 Ga0055525_1000241 3300003759 Bacteria 56036
7 Ga0070666_10424394 3300005335 Bacteria 958
8 Ga0068868_100500545 3300005338 Bacteria 1064
9 Ga0068868_100665064 3300005338 Bacteria 929
10 Ga0070667_100471888 3300005367 Bacteria 1148
11 Ga0068863_100116598 3300005841 Bacteria 2545
12 Ga0075364_10100087 3300006051 Bacteria 1930
13 Ga0105251_10111507 3300009011 Bacteria 1246
14 Ga0105246_10069976 3300011119 Bacteria 2466
15 Ga0157369_10041895 3300013105 Bacteria 4997
16 Ga0157369_10981108 3300013105 Bacteria 865
17 Ga0163162_10247619 3300013306 Bacteria 1914
18 Ga0157372_10687820 3300013307 Bacteria 1190
19 Ga0163163_10405230 3300014325 Bacteria 1422
20 Ga0209566_100032 3300025225 Bacteria 338313
21 Ga0209674_100001 3300025226 Bacteria 4013750
22 Ga0209563_100001 3300025230 Bacteria 4013775
23 Ga0209563_100702 3300025230 Bacteria 10489
24 Ga0207427_100041 3300025231 Bacteria 263659
25 Ga0209437_100267 3300025233 Bacteria 79455
26 Ga0209677_100001 3300025253 Bacteria 4013787
27 Ga0209233_1000014 3300025261 Bacteria 996641
28 Ga0207647_10370535 3300025904 Bacteria 809
29 Ga0207658_10224557 3300025986 Bacteria 1582
30 Ga0207677_10507646 3300026023 Bacteria 1044
31 Ga0207641_10097350 3300026088 Bacteria 2586
32 Ga0314311_1099752 3300030733 Bacteria 812
33 Ga0307514_10006675 3300031649 Bacteria 10007
34 Ga0307410_10076159 3300031852 Bacteria 2341
35 Ga0307406_10001673 3300031901 Bacteria 12187
36 Ga0307407_10726783 3300031903 Bacteria 750
37 Ga0307409_100980590 3300031995 Bacteria 862
38 Ga0307409_101862772 3300031995 Bacteria 631
39 Ga0307416_100181931 3300032002 Bacteria 1971
40 Ga0307414_11367174 3300032004 Bacteria 658
41 Ga0451793_1044995 3300041452 Bacteria 845
42 Ga0451797_0074411 3300041453 Bacteria 983
43 Ga0451797_0115390 3300041453 Bacteria 620
44 Ga0451807_0400443 3300041486 Bacteria 1487
45 Ga0451853_4051880 3300041512 Bacteria 540
46 Ga0466972_0016984 3300044658 Bacteria 3641
47 Ga0466972_0046835 3300044658 Bacteria 2092
48 Ga0466965_0009128 3300044683 Bacteria 4603
49 Ga0466965_0171468 3300044683 Bacteria 1142
50 Ga0466966_0024193 3300044684 Bacteria 3975
51 Ga0466961_0337487 3300044693 Bacteria 918
52 Ga0466970_0051251 3300044765 Bacteria 2202
53 Ga0466957_0141957 3300044842 Bacteria 1548
54 Ga0466960_0018531 3300044901 Bacteria 3053
55 Ga0466960_0030830 3300044901 Bacteria 2470
56 Ga0466959_0019793 3300045049 Bacteria 4952
57 Ga0495609_0183553 3300046538 Bacteria 880
58 Ga0495600_0425733 3300046809 Bacteria 823
59 Ga0495675_0106108 3300047444 Bacteria 1756
60 Ga0496101_0452542 3300048904 Bacteria 1013
61 Ga0496102_1592401 3300048905 Bacteria 571
62 Ga0496117_0001996 3300048920 Bacteria 27057
63 Ga0496117_0002355 3300048920 Bacteria 24155
64 Ga0496117_0014908 3300048920 Bacteria 6665
65 Ga0496118_0000290 3300048921 Bacteria 87438
66 Ga0496119_0000406 3300048922 Bacteria 59160
67 Ga0496119_0013475 3300048922 Bacteria 6506
68 Ga0496119_0090717 3300048922 Bacteria 1737
69 Ga0496119_0114472 3300048922 Bacteria 1492
70 Ga0496120_0001223 3300048923 Bacteria 32482
71 Ga0496120_0033811 3300048923 Bacteria 3069
72 Ga0496120_0357314 3300048923 Bacteria 655
73 Ga0496122_0000098 3300048925 Bacteria 198547
74 Ga0496122_0001827 3300048925 Bacteria 32452
75 Ga0496122_0016935 3300048925 Bacteria 6849
76 Ga0496122_0038946 3300048925 Bacteria 3798
77 Ga0496122_0040017 3300048925 Bacteria 3732
78 Ga0496122_0214661 3300048925 Bacteria 1110
79 Ga0496123_0000420 3300048926 Bacteria 77105
80 Ga0496123_0005099 3300048926 Bacteria 13411
81 Ga0496123_0049175 3300048926 Bacteria 2830
82 Ga0496124_0000040 3300048927 Bacteria 307061
83 Ga0496124_0007401 3300048927 Bacteria 11676
84 Ga0496124_0080262 3300048927 Bacteria 2685
85 Ga0496124_0378828 3300048927 Bacteria 990
86 Ga0496125_0002794 3300048928 Bacteria 22070
87 Ga0496125_0007234 3300048928 Bacteria 11826
88 Ga0496126_0433268 3300048929 Bacteria 1061
89 Ga0501032_0082529 3300049569 Bacteria 2138
90 Ga0501033_0008362 3300049570 Bacteria 8013
91 Ga0501033_0028671 3300049570 Bacteria 4182
92 Ga0501034_0027081 3300049571 Bacteria 5832
93 Ga0501036_0053503 3300049572 Bacteria 3418
94 Ga0501038_0171123 3300049574 Bacteria 1758
95 Ga0501042_0127985 3300049578 Bacteria 1829
96 Ga0501043_0082908 3300049579 Bacteria 2521
97 Ga0501046_0006076 3300049580 Bacteria 10744
98 Ga0501046_0027961 3300049580 Bacteria 4596
99 Ga0501047_0000312 3300049581 Bacteria 56050
100 Ga0501048_0006665 3300049582 Bacteria 8772
101 Ga0501073_0776969 3300049589 Bacteria 660
102 Ga0501080_0490408 3300049742 Bacteria 1099
103 Ga0501035_0008763 3300049822 Bacteria 9417
104 Ga0501035_0040178 3300049822 Bacteria 4229
105 Ga0501044_0032085 3300049823 Bacteria 5522
106 nmdc:mga00v17_21243_c1 3300050491 Bacteria 3730
107 Ga0500635_0000002 3300053080 Bacteria 265613
108 Ga0500559_0004435 3300053136 Bacteria 6666
109 Ga0500559_0005733 3300053136 Bacteria 5674
110 Ga0500559_0243998 3300053136 Bacteria 846
111 Ga0500573_0000154 3300053140 Bacteria 27843
112 Ga0500573_0051747 3300053140 Bacteria 2362
113 Ga0500573_0321393 3300053140 Bacteria 764
114 Ga0500577_0106449 3300053142 Bacteria 1152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10247619 Ga0163162_102476193 147
2 3300014325 Ga0163163_10405230 Ga0163163_104052302 147
3 3300044658 Ga0466972_0016984 Ga0466972_0016984_2812_3345 154
4 3300048922 Ga0496119_0000406 Ga0496119_0000406_5359_5868 157
5 3300048923 Ga0496120_0001223 Ga0496120_0001223_13611_14120 157
6 3300053136 Ga0500559_0005733 Ga0500559_0005733_4919_5443 157
7 3300053136 Ga0500559_0243998 Ga0500559_0243998_97_621 157
8 3300048925 Ga0496122_0038946 Ga0496122_0038946_1709_2230 158
9 3300048926 Ga0496123_0049175 Ga0496123_0049175_1665_2186 158
10 3300053136 Ga0500559_0004435 Ga0500559_0004435_103_612 158
11 iso_pu_bacteria 2857723135 2857725530 159
12 iso_pu_bacteria 2946080515 2946082790 159
13 iso_pu_bacteria 2751185788 2753302953 160
14 iso_pu_bacteria 2808606372 2808900942 160
15 iso_pu_bacteria 2857729791 2857731356 160
16 iso_pu_bacteria 2919042368 2919042624 160
17 iso_pu_bacteria 2928104781 2928104933 160
18 iso_pu_bacteria 2928121344 2928122103 160
19 iso_pu_bacteria 2966921586 2966922976 160
20 iso_pu_bacteria 2984551494 2984555095 160
21 iso_pu_bacteria 2757320536 2758224457 161
22 iso_pu_bacteria 2897561785 2897562372 161
23 iso_pu_bacteria 2977264416 2977265871 161
24 iso_pu_bacteria 8004182704 8004182995 161
25 iso_pu_bacteria 2643221632 2644182626 162
26 iso_pu_bacteria 2738541272 2738694613 162
27 iso_pu_bacteria 2738543027 2739325990 162
28 iso_pu_bacteria 2739367654 2739608615 162
29 iso_pu_bacteria 2758568522 2760304008 162
30 iso_pu_bacteria 2808606394 2809030396 162
31 iso_pu_bacteria 2811994880 2812364985 162
32 iso_pu_bacteria 2844852863 2844854266 162
33 iso_pu_bacteria 2857720070 2857720504 162
34 iso_pu_bacteria 2857733635 2857734764 162
35 iso_pu_bacteria 2870622029 2870622415 162
36 iso_pu_bacteria 2884763398 2884763800 162
37 iso_pu_bacteria 2904501621 2904502236 162
38 iso_pu_bacteria 2908674828 2908677248 162
39 iso_pu_bacteria 2909074476 2909076179 162
40 iso_pu_bacteria 2919039151 2919042290 162
41 iso_pu_bacteria 2928500415 2928503199 162
42 iso_pu_bacteria 2945941187 2945945583 162
43 iso_pu_bacteria 2945968032 2945970025 162
44 iso_pu_bacteria 2946041624 2946042395 162
45 iso_pu_bacteria 2964326757 2964328043 162
46 iso_pu_bacteria 8056579771 8056582806 162
47 3300031903 Ga0307407_10726783 Ga0307407_107267831 163
48 3300044683 Ga0466965_0009128 Ga0466965_0009128_3941_4474 163
49 3300044842 Ga0466957_0141957 Ga0466957_0141957_758_1291 163
50 3300044901 Ga0466960_0030830 Ga0466960_0030830_787_1320 163
51 3300048925 Ga0496122_0016935 Ga0496122_0016935_672_1163 163
52 3300048928 Ga0496125_0002794 Ga0496125_0002794_19247_19738 163
53 3300049569 Ga0501032_0082529 Ga0501032_0082529_296_787 163
54 3300049570 Ga0501033_0008362 Ga0501033_0008362_2989_3480 163
55 3300049570 Ga0501033_0028671 Ga0501033_0028671_633_1124 163
56 3300049571 Ga0501034_0027081 Ga0501034_0027081_808_1299 163
57 3300049572 Ga0501036_0053503 Ga0501036_0053503_1493_1984 163
58 3300049574 Ga0501038_0171123 Ga0501038_0171123_214_705 163
59 3300049578 Ga0501042_0127985 Ga0501042_0127985_531_1022 163
60 3300049579 Ga0501043_0082908 Ga0501043_0082908_16_507 163
61 3300049580 Ga0501046_0006076 Ga0501046_0006076_7115_7606 163
62 3300049580 Ga0501046_0027961 Ga0501046_0027961_4094_4585 163
63 3300049581 Ga0501047_0000312 Ga0501047_0000312_4534_5025 163
64 3300049582 Ga0501048_0006665 Ga0501048_0006665_2210_2701 163
65 3300049589 Ga0501073_0776969 Ga0501073_0776969_86_577 163
66 3300049742 Ga0501080_0490408 Ga0501080_0490408_332_823 163
67 3300049822 Ga0501035_0008763 Ga0501035_0008763_4715_5206 163
68 3300049822 Ga0501035_0040178 Ga0501035_0040178_2420_2911 163
69 3300049823 Ga0501044_0032085 Ga0501044_0032085_862_1353 163
70 3300003752 Ga0055539_1000006 Ga0055539_100000659 164
71 3300003756 Ga0055533_1000002 Ga0055533_1000002143 164
72 3300003759 Ga0055525_1000241 Ga0055525_100024145 164
73 3300009011 Ga0105251_10111507 Ga0105251_101115072 164
74 3300013105 Ga0157369_10041895 Ga0157369_100418953 164
75 3300025225 Ga0209566_100032 Ga0209566_100032144 164
76 3300025226 Ga0209674_100001 Ga0209674_1000013421 164
77 3300025230 Ga0209563_100001 Ga0209563_1000013421 164
78 3300025253 Ga0209677_100001 Ga0209677_1000013421 164
79 3300031852 Ga0307410_10076159 Ga0307410_100761592 164
80 3300031995 Ga0307409_100980590 Ga0307409_1009805902 164
81 3300032002 Ga0307416_100181931 Ga0307416_1001819313 164
82 3300041512 Ga0451853_4051880 Ga0451853_4051880_10_513 164
83 3300048904 Ga0496101_0452542 Ga0496101_0452542_328_822 164
84 3300048920 Ga0496117_0001996 Ga0496117_0001996_23837_24331 164
85 3300048920 Ga0496117_0014908 Ga0496117_0014908_4249_4758 164
86 3300048921 Ga0496118_0000290 Ga0496118_0000290_53414_53908 164
87 3300048922 Ga0496119_0013475 Ga0496119_0013475_4898_5392 164
88 3300048923 Ga0496120_0033811 Ga0496120_0033811_1248_1742 164
89 3300048923 Ga0496120_0357314 Ga0496120_0357314_117_611 164
90 3300048925 Ga0496122_0040017 Ga0496122_0040017_2939_3433 164
91 3300048925 Ga0496122_0214661 Ga0496122_0214661_496_1005 164
92 3300048927 Ga0496124_0000040 Ga0496124_0000040_222921_223415 164
93 3300053080 Ga0500635_0000002 Ga0500635_0000002_190423_190917 164
94 3300025230 Ga0209563_100702 Ga0209563_1007024 165
95 3300041486 Ga0451807_0400443 Ga0451807_0400443_479_1000 165
96 3300048927 Ga0496124_0378828 Ga0496124_0378828_159_656 165
97 3300002737 JGI25162J39368_1006719 JGI25162J39368_10067192 166
98 3300002772 JGI25164J39214_1000385 JGI25164J39214_100038517 166
99 3300003214 JGI25165J46597_1000014 JGI25165J46597_1000014335 166
100 3300005335 Ga0070666_10424394 Ga0070666_104243942 166
101 3300005338 Ga0068868_100500545 Ga0068868_1005005452 166
102 3300005338 Ga0068868_100665064 Ga0068868_1006650642 166
103 3300005367 Ga0070667_100471888 Ga0070667_1004718882 166
104 3300005841 Ga0068863_100116598 Ga0068863_1001165982 166
105 3300006051 Ga0075364_10100087 Ga0075364_101000872 166
106 3300011119 Ga0105246_10069976 Ga0105246_100699763 166
107 3300013105 Ga0157369_10981108 Ga0157369_109811081 166
108 3300013307 Ga0157372_10687820 Ga0157372_106878202 166
109 3300025231 Ga0207427_100041 Ga0207427_100041124 166
110 3300025233 Ga0209437_100267 Ga0209437_10026737 166
111 3300025261 Ga0209233_1000014 Ga0209233_1000014743 166
112 3300025904 Ga0207647_10370535 Ga0207647_103705351 166
113 3300025986 Ga0207658_10224557 Ga0207658_102245572 166
114 3300026023 Ga0207677_10507646 Ga0207677_105076462 166
115 3300026088 Ga0207641_10097350 Ga0207641_100973503 166
116 3300030733 Ga0314311_1099752 Ga0314311_10997521 166
117 3300031649 Ga0307514_10006675 Ga0307514_100066753 166
118 3300031901 Ga0307406_10001673 Ga0307406_100016736 166
119 3300031995 Ga0307409_101862772 Ga0307409_1018627721 166
120 3300032004 Ga0307414_11367174 Ga0307414_113671741 166
121 3300041452 Ga0451793_1044995 Ga0451793_1044995_32_604 166
122 3300041453 Ga0451797_0074411 Ga0451797_0074411_302_802 166
123 3300041453 Ga0451797_0115390 Ga0451797_0115390_81_581 166
124 3300044658 Ga0466972_0046835 Ga0466972_0046835_288_791 166
125 3300044683 Ga0466965_0171468 Ga0466965_0171468_606_1124 166
126 3300044684 Ga0466966_0024193 Ga0466966_0024193_501_1004 166
127 3300044693 Ga0466961_0337487 Ga0466961_0337487_130_633 166
128 3300044765 Ga0466970_0051251 Ga0466970_0051251_436_942 166
129 3300044901 Ga0466960_0018531 Ga0466960_0018531_1591_2094 166
130 3300045049 Ga0466959_0019793 Ga0466959_0019793_2146_2649 166
131 3300046538 Ga0495609_0183553 Ga0495609_0183553_314_814 166
132 3300046809 Ga0495600_0425733 Ga0495600_0425733_240_740 166
133 3300047444 Ga0495675_0106108 Ga0495675_0106108_703_1203 166
134 3300048905 Ga0496102_1592401 Ga0496102_1592401_37_537 166
135 3300048920 Ga0496117_0002355 Ga0496117_0002355_14157_14663 166
136 3300048922 Ga0496119_0090717 Ga0496119_0090717_187_699 166
137 3300048922 Ga0496119_0114472 Ga0496119_0114472_477_1004 166
138 3300048925 Ga0496122_0000098 Ga0496122_0000098_138700_139227 166
139 3300048925 Ga0496122_0001827 Ga0496122_0001827_3566_4066 166
140 3300048926 Ga0496123_0000420 Ga0496123_0000420_50751_51278 166
141 3300048926 Ga0496123_0005099 Ga0496123_0005099_3375_3875 166
142 3300048927 Ga0496124_0007401 Ga0496124_0007401_2297_2803 166
143 3300048927 Ga0496124_0080262 Ga0496124_0080262_2074_2601 166
144 3300048928 Ga0496125_0007234 Ga0496125_0007234_5152_5652 166
145 3300048929 Ga0496126_0433268 Ga0496126_0433268_206_718 166
146 3300050491 nmdc:mga00v17_21243_c1 nmdc:mga00v17_21243_c1_1835_2335 166
147 3300053140 Ga0500573_0000154 Ga0500573_0000154_22227_22730 166
148 3300053140 Ga0500573_0051747 Ga0500573_0051747_250_750 166
149 3300053140 Ga0500573_0321393 Ga0500573_0321393_245_745 166
150 3300053142 Ga0500577_0106449 Ga0500577_0106449_167_667 166
151 iso_pu_bacteria 8056037122 8056038715 166

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zmd-assembly2.cif.gz_D crystal structure of absc, a marr family transcriptional regulator from streptomyces coelicolor 0.9475 6 152
3zpl-assembly2.cif.gz_F crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9436 7 157
3zpl-assembly1.cif.gz_B crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9417 5 156
5w1e-assembly1.cif.gz_A pobr in complex with phb 0.9361 43 105
3zpl-assembly2.cif.gz_E crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9309 2 157
ID Description Score Start End Superfamily
3zplA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9646 5 150 1.10.10.10
3zmdA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9427 6 152 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9379 43 105 1.10.10.10
1s3jB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9286 40 105 1.10.10.10
3zmdA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9245 6 152 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6G9F6K0-F1-model_v4 deleted 0.9735 16 146
AF-A0A1H9XTY2-F1-model_v4 DNA-binding transcriptional regulator, MarR family 0.9698 4 146 GO:0003677
GO:0003700
GO:0006950
AF-A0A0M9ZY29-F1-model_v4 MarR family transcriptional regulator 0.9697 4 149 GO:0003700
GO:0006950
AF-A0A522BZK0-F1-model_v4 MarR family transcriptional regulator 0.9687 6 146 GO:0003700
GO:0006950
AF-A0A229TL59-F1-model_v4 MarR family transcriptional regulator 0.9676 6 150 GO:0003700
GO:0006950

Feature Viewer

pLDDT pTM Quality
88.72 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map