F211831

General Info

Members Datasets Scaffolds Average Seq Length
151 96 151 297

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10239648|Ga0207674_102396482
Length 324
Sequence MKRSVSQAVKLGLIQTDVAANPAANLKKTLALVERAAKSGAQIICTQELFRSQYFCQSEDHKNFELAEKIPGPSTDAFQKLAKKHKVVIIASLFEKRASGVYHNTAAIIDADGSMLGIYRKMHIPDDPLFYEKFYFTPGDLGFKTWQTRYGKIGVLICWDQWYPEAARLTAMQGAEILFYPTAIGWHPSEKKEYGERQHGAWETIQRSHAVANGCFVASVNRIGHEVIQGVGGDGLEFWGQSFFMPGVQSATSPGGKRCRITLRTIKTNFQPNTITIAETCSAAATKREPESFVKTLKTPLYPTAPLTASCAWMRSIRKTLTAT

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
5 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
13 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
14 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
20 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
21 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
24 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
25 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
26 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
39 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
40 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
41 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
42 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
43 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
46 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
50 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
51 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
52 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
53 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
54 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
55 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
56 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
57 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
58 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
59 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
60 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
72 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
75 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
76 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
77 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
78 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
83 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
84 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
85 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
92 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
93 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
94 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
95 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
96 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.66
Rhizosphere 95.36
Stem 0
Stem Tuber 0
Unclassified 3.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10241857 3300005327 Bacteria 1530
2 Ga0070683_100015510 3300005329 Bacteria 6696
3 Ga0070683_100155942 3300005329 Bacteria 2165
4 Ga0070689_100002964 3300005340 Bacteria 11151
5 Ga0070689_100092740 3300005340 Bacteria 2382
6 Ga0070689_100391115 3300005340 Bacteria 1173
7 Ga0070701_10210336 3300005438 Bacteria 1155
8 Ga0070684_100057235 3300005535 Bacteria 3403
9 Ga0070684_100104825 3300005535 Bacteria 2530
10 Ga0068855_100052715 3300005563 Bacteria 4788
11 Ga0068855_100059320 3300005563 Bacteria 4477
12 Ga0068855_100369179 3300005563 Bacteria 1578
13 Ga0070664_100019997 3300005564 Bacteria 5511
14 Ga0068857_100000613 3300005577 Bacteria 26259
15 Ga0068857_100142471 3300005577 Bacteria 2167
16 Ga0068856_100006046 3300005614 Bacteria 11897
17 Ga0068859_100054796 3300005617 Bacteria 4012
18 Ga0068859_100324303 3300005617 Bacteria 1634
19 Ga0068863_100049477 3300005841 Bacteria 3986
20 Ga0068863_100058805 3300005841 Bacteria 3638
21 Ga0068871_100040644 3300006358 Bacteria 3726
22 Ga0068871_100271668 3300006358 Bacteria 1481
23 Ga0068865_100070285 3300006881 Bacteria 2480
24 Ga0097620_100054796 3300006931 Bacteria 4012
25 Ga0097620_100324292 3300006931 Bacteria 1634
26 Ga0075435_100071102 3300007076 Bacteria 2841
27 Ga0105240_10000136 3300009093 Bacteria 150544
28 Ga0105240_10008477 3300009093 Bacteria 14699
29 Ga0105240_10507703 3300009093 Bacteria 1340
30 Ga0105242_10027078 3300009176 Unclassified 4548
31 Ga0105242_10203027 3300009176 Bacteria 1762
32 Ga0105238_10149377 3300009551 Bacteria 2312
33 Ga0105249_10599525 3300009553 Bacteria 1156
34 Ga0157374_10000028 3300013296 Bacteria 213725
35 Ga0157378_10028392 3300013297 Bacteria 4936
36 Ga0163163_10000146 3300014325 Bacteria 73162
37 Ga0163163_10445867 3300014325 Bacteria 1354
38 Ga0157376_10000742 3300014969 Bacteria 21200
39 Ga0157376_10544530 3300014969 Bacteria 1148
40 Ga0213876_10000648 3300021384 Bacteria 25072
41 Ga0213876_10101317 3300021384 Bacteria 1527
42 Ga0213875_10064549 3300021388 Bacteria 1711
43 Ga0207695_10000226 3300025913 Bacteria 150570
44 Ga0207695_10034017 3300025913 Bacteria 5549
45 Ga0207695_10118564 3300025913 Bacteria 2617
46 Ga0207663_10015583 3300025916 Bacteria 4198
47 Ga0207652_10180001 3300025921 Bacteria 1899
48 Ga0207694_10016298 3300025924 Bacteria 5609
49 Ga0207694_10130909 3300025924 Bacteria 2011
50 Ga0207670_10005625 3300025936 Bacteria 6892
51 Ga0207670_10006119 3300025936 Bacteria 6654
52 Ga0207689_10195887 3300025942 Bacteria 1667
53 Ga0207667_10023483 3300025949 Bacteria 6790
54 Ga0207667_10303976 3300025949 Bacteria 1630
55 Ga0207677_10148103 3300026023 Bacteria 1807
56 Ga0207677_10445292 3300026023 Bacteria 1109
57 Ga0207702_10002801 3300026078 Bacteria 16327
58 Ga0207702_10007584 3300026078 Bacteria 9238
59 Ga0207641_10176185 3300026088 Bacteria 1955
60 Ga0207674_10003585 3300026116 Bacteria 18926
61 Ga0207674_10239648 3300026116 Bacteria 1761
62 Ga0268265_10370818 3300028380 Bacteria 1314
63 Ga0265319_1000013 3300028563 Bacteria 180699
64 Ga0265336_10043638 3300028666 Bacteria 1366
65 Ga0265338_10000008 3300028800 Bacteria 481542
66 Ga0265338_10000269 3300028800 Bacteria 95081
67 Ga0265338_10001031 3300028800 Bacteria 46585
68 Ga0265338_10018860 3300028800 Bacteria 7357
69 Ga0265338_10066875 3300028800 Bacteria 3108
70 Ga0265338_10181242 3300028800 Bacteria 1605
71 Ga0265324_10000487 3300029957 Bacteria 27736
72 Ga0265324_10000543 3300029957 Bacteria 25808
73 Ga0265324_10012395 3300029957 Bacteria 3214
74 Ga0265324_10026115 3300029957 Bacteria 2068
75 Ga0265324_10104290 3300029957 Bacteria 963
76 Ga0265320_10008027 3300031240 Bacteria 6500
77 Ga0265340_10001426 3300031247 Bacteria 13719
78 Ga0265327_10001087 3300031251 Bacteria 37858
79 Ga0265313_10003469 3300031595 Bacteria 12730
80 Ga0316579_10098137 3300031691 Bacteria 1402
81 Ga0307405_10057484 3300031731 Bacteria 2444
82 Ga0307409_100183912 3300031995 Bacteria 1853
83 Ga0307415_100277916 3300032126 Bacteria 1375
84 Ga0373950_0005522 3300034818 Bacteria 1893
85 Ga0373928_0001431 3300035084 Bacteria 4628
86 Ga0373944_0000150 3300035089 Bacteria 13698
87 Ga0373949_0002913 3300035090 Bacteria 4220
88 Ga0373951_0003636 3300035091 Bacteria 3717
89 Ga0373932_0000005 3300035112 Bacteria 259528
90 Ga0373954_0028343 3300035118 Bacteria 2575
91 Ga0373956_0005483 3300035119 Bacteria 5079
92 Ga0373962_0006398 3300035242 Bacteria 2853
93 Ga0373931_0000016 3300035691 Bacteria 217932
94 Ga0373931_0041021 3300035691 Bacteria 2431
95 Ga0373927_0118298 3300035695 Bacteria 1729
96 Ga0373927_0166304 3300035695 Bacteria 1445
97 Ga0373933_0314211 3300035724 Bacteria 1015
98 Ga0373937_0118696 3300036401 Bacteria 2464
99 Ga0373937_0151287 3300036401 Bacteria 2174
100 Ga0373937_0155274 3300036401 Bacteria 2144
101 Ga0373925_0000485 3300037068 Bacteria 39875
102 Ga0373925_0015215 3300037068 Bacteria 5563
103 Ga0395905_0139625 3300037471 Bacteria 2280
104 Ga0436364_1386369 3300037853 Bacteria 2545
105 Ga0436365_0013805 3300039437 Bacteria 20346
106 Ga0436365_1412451 3300039437 Bacteria 1267
107 Ga0451577_0023301 3300042876 Bacteria 5647
108 Ga0453684_0000238 3300044712 Bacteria 236003
109 Ga0453684_0034932 3300044712 Bacteria 6962
110 Ga0453684_0391199 3300044712 Bacteria 1559
111 Ga0453684_0474800 3300044712 Bacteria 1388
112 Ga0451576_0000206 3300045051 Bacteria 147691
113 Ga0451576_0001081 3300045051 Bacteria 49954
114 Ga0451576_0007854 3300045051 Bacteria 12644
115 Ga0451576_0008606 3300045051 Bacteria 11956
116 Ga0451576_0072396 3300045051 Bacteria 3587
117 Ga0451576_0246987 3300045051 Bacteria 1865
118 Ga0451576_0397234 3300045051 Bacteria 1445
119 Ga0495592_0015043 3300046454 Bacteria 5876
120 Ga0495629_0111004 3300046459 Bacteria 1912
121 Ga0495594_0163166 3300046499 Bacteria 1267
122 Ga0495628_0167481 3300046516 Bacteria 1667
123 Ga0495628_0353423 3300046516 Bacteria 1080
124 Ga0495630_0044459 3300046517 Bacteria 3319
125 Ga0495645_0052460 3300046543 Bacteria 2967
126 Ga0495667_0017584 3300046559 Bacteria 4830
127 Ga0495657_0065809 3300046675 Bacteria 2383
128 Ga0495599_0056744 3300046678 Bacteria 2451
129 Ga0495599_0119948 3300046678 Bacteria 1635
130 Ga0495604_0256230 3300047317 Bacteria 1191
131 Ga0495674_0003764 3300047319 Bacteria 14750
132 Ga0495674_0166138 3300047319 Bacteria 1844
133 Ga0495680_0331020 3300047322 Bacteria 1064
134 Ga0495675_0061542 3300047444 Bacteria 2378
135 Ga0495684_0016178 3300047471 Bacteria 5744
136 Ga0495684_0026237 3300047471 Bacteria 4477
137 Ga0496115_0023021 3300048918 Bacteria 4832
138 Ga0501031_0000039 3300049568 Bacteria 72794
139 Ga0501031_0140199 3300049568 Bacteria 1580
140 Ga0501032_0008417 3300049569 Bacteria 7525
141 Ga0501033_0002435 3300049570 Bacteria 15815
142 Ga0501036_0239296 3300049572 Bacteria 1523
143 Ga0501037_0027628 3300049573 Bacteria 4193
144 Ga0501047_0049837 3300049581 Bacteria 4043
145 Ga0501076_0465505 3300049592 Bacteria 1041
146 Ga0501044_0000133 3300049823 Bacteria 91116
147 Ga0501044_0006544 3300049823 Bacteria 12860
148 nmdc:mga06r32_143904_c1 3300050510 Bacteria 2361
149 nmdc:mga08y16_260942_c1 3300050511 Bacteria 1789
150 nmdc:mga0rr50_224571_c1 3300050513 Bacteria 1223
151 Ga0495601_0169746 3300053077 Bacteria 1426

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005438 Ga0070701_10210336 Ga0070701_102103361 266
2 3300028380 Ga0268265_10370818 Ga0268265_103708181 282
3 3300035695 Ga0373927_0118298 Ga0373927_0118298_574_1443 289
4 3300047471 Ga0495684_0026237 Ga0495684_0026237_2740_3609 289
5 3300005329 Ga0070683_100015510 Ga0070683_1000155105 290
6 3300005535 Ga0070684_100057235 Ga0070684_1000572353 290
7 3300005564 Ga0070664_100019997 Ga0070664_1000199973 290
8 3300021384 Ga0213876_10000648 Ga0213876_1000064820 290
9 3300021384 Ga0213876_10101317 Ga0213876_101013172 290
10 3300021388 Ga0213875_10064549 Ga0213875_100645492 290
11 3300037853 Ga0436364_1386369 Ga0436364_1386369_700_1572 290
12 3300039437 Ga0436365_0013805 Ga0436365_0013805_9821_10693 290
13 3300039437 Ga0436365_1412451 Ga0436365_1412451_167_1039 290
14 3300045051 Ga0451576_0001081 Ga0451576_0001081_45204_46079 290
15 3300005577 Ga0068857_100000613 Ga0068857_1000006137 291
16 3300009093 Ga0105240_10000136 Ga0105240_1000013647 291
17 3300014969 Ga0157376_10544530 Ga0157376_105445302 291
18 3300025913 Ga0207695_10000226 Ga0207695_1000022647 291
19 3300026116 Ga0207674_10003585 Ga0207674_100035857 291
20 3300045051 Ga0451576_0000206 Ga0451576_0000206_59749_60627 291
21 3300045051 Ga0451576_0007854 Ga0451576_0007854_9368_10249 291
22 3300049592 Ga0501076_0465505 Ga0501076_0465505_103_1002 291
23 3300005617 Ga0068859_100054796 Ga0068859_1000547962 292
24 3300005841 Ga0068863_100049477 Ga0068863_1000494772 292
25 3300006358 Ga0068871_100040644 Ga0068871_1000406443 292
26 3300006881 Ga0068865_100070285 Ga0068865_1000702852 292
27 3300006931 Ga0097620_100054796 Ga0097620_1000547962 292
28 3300007076 Ga0075435_100071102 Ga0075435_1000711022 292
29 3300009093 Ga0105240_10008477 Ga0105240_1000847710 292
30 3300009176 Ga0105242_10203027 Ga0105242_102030272 292
31 3300014325 Ga0163163_10000146 Ga0163163_1000014639 292
32 3300025913 Ga0207695_10034017 Ga0207695_100340174 292
33 3300026023 Ga0207677_10148103 Ga0207677_101481032 292
34 3300028800 Ga0265338_10001031 Ga0265338_1000103131 292
35 3300031691 Ga0316579_10098137 Ga0316579_100981371 292
36 3300035691 Ga0373931_0041021 Ga0373931_0041021_1354_2250 292
37 3300036401 Ga0373937_0118696 Ga0373937_0118696_797_1690 292
38 3300036401 Ga0373937_0155274 Ga0373937_0155274_984_1877 292
39 3300037471 Ga0395905_0139625 Ga0395905_0139625_156_1037 292
40 3300044712 Ga0453684_0474800 Ga0453684_0474800_141_1034 292
41 3300045051 Ga0451576_0072396 Ga0451576_0072396_2195_3088 292
42 3300046516 Ga0495628_0353423 Ga0495628_0353423_120_1004 292
43 3300046678 Ga0495599_0056744 Ga0495599_0056744_857_1741 292
44 3300047317 Ga0495604_0256230 Ga0495604_0256230_71_964 292
45 3300050513 nmdc:mga0rr50_224571_c1 nmdc:mga0rr50_224571_c1_176_1126 292
46 3300053077 Ga0495601_0169746 Ga0495601_0169746_447_1331 292
47 3300005340 Ga0070689_100002964 Ga0070689_1000029646 293
48 3300005340 Ga0070689_100092740 Ga0070689_1000927404 293
49 3300005340 Ga0070689_100391115 Ga0070689_1003911151 293
50 3300005577 Ga0068857_100142471 Ga0068857_1001424712 293
51 3300005617 Ga0068859_100324303 Ga0068859_1003243032 293
52 3300005841 Ga0068863_100058805 Ga0068863_1000588053 293
53 3300006358 Ga0068871_100271668 Ga0068871_1002716682 293
54 3300006931 Ga0097620_100324292 Ga0097620_1003242922 293
55 3300009176 Ga0105242_10027078 Ga0105242_100270782 293
56 3300013296 Ga0157374_10000028 Ga0157374_10000028187 293
57 3300013297 Ga0157378_10028392 Ga0157378_100283923 293
58 3300014325 Ga0163163_10445867 Ga0163163_104458672 293
59 3300014969 Ga0157376_10000742 Ga0157376_1000074211 293
60 3300025936 Ga0207670_10005625 Ga0207670_100056255 293
61 3300025936 Ga0207670_10006119 Ga0207670_100061196 293
62 3300026088 Ga0207641_10176185 Ga0207641_101761852 293
63 3300028800 Ga0265338_10181242 Ga0265338_101812421 293
64 3300031240 Ga0265320_10008027 Ga0265320_100080274 293
65 3300044712 Ga0453684_0000238 Ga0453684_0000238_35299_36186 293
66 3300044712 Ga0453684_0034932 Ga0453684_0034932_1791_2690 293
67 3300045051 Ga0451576_0008606 Ga0451576_0008606_797_1693 293
68 3300046675 Ga0495657_0065809 Ga0495657_0065809_176_1066 293
69 3300050510 nmdc:mga06r32_143904_c1 nmdc:mga06r32_143904_c1_1385_2278 293
70 3300050511 nmdc:mga08y16_260942_c1 nmdc:mga08y16_260942_c1_177_1070 293
71 3300025942 Ga0207689_10195887 Ga0207689_101958872 294
72 3300031731 Ga0307405_10057484 Ga0307405_100574841 294
73 3300031995 Ga0307409_100183912 Ga0307409_1001839121 294
74 3300032126 Ga0307415_100277916 Ga0307415_1002779162 294
75 3300046499 Ga0495594_0163166 Ga0495594_0163166_147_1040 294
76 3300049572 Ga0501036_0239296 Ga0501036_0239296_204_1097 294
77 3300005327 Ga0070658_10241857 Ga0070658_102418572 295
78 3300005329 Ga0070683_100155942 Ga0070683_1001559423 295
79 3300005535 Ga0070684_100104825 Ga0070684_1001048252 295
80 3300005563 Ga0068855_100052715 Ga0068855_1000527155 295
81 3300005563 Ga0068855_100059320 Ga0068855_1000593203 295
82 3300005563 Ga0068855_100369179 Ga0068855_1003691792 295
83 3300005614 Ga0068856_100006046 Ga0068856_1000060466 295
84 3300009093 Ga0105240_10507703 Ga0105240_105077031 295
85 3300009551 Ga0105238_10149377 Ga0105238_101493772 295
86 3300009553 Ga0105249_10599525 Ga0105249_105995251 295
87 3300025913 Ga0207695_10118564 Ga0207695_101185642 295
88 3300025916 Ga0207663_10015583 Ga0207663_100155834 295
89 3300025921 Ga0207652_10180001 Ga0207652_101800012 295
90 3300025924 Ga0207694_10016298 Ga0207694_100162986 295
91 3300025924 Ga0207694_10130909 Ga0207694_101309092 295
92 3300025949 Ga0207667_10023483 Ga0207667_100234835 295
93 3300025949 Ga0207667_10303976 Ga0207667_103039762 295
94 3300026023 Ga0207677_10445292 Ga0207677_104452921 295
95 3300026078 Ga0207702_10002801 Ga0207702_100028012 295
96 3300026078 Ga0207702_10007584 Ga0207702_100075845 295
97 3300026116 Ga0207674_10239648 Ga0207674_102396482 295
98 3300028563 Ga0265319_1000013 Ga0265319_10000138 295
99 3300028666 Ga0265336_10043638 Ga0265336_100436382 295
100 3300028800 Ga0265338_10000008 Ga0265338_10000008146 295
101 3300028800 Ga0265338_10000269 Ga0265338_1000026980 295
102 3300028800 Ga0265338_10018860 Ga0265338_100188602 295
103 3300028800 Ga0265338_10066875 Ga0265338_100668754 295
104 3300029957 Ga0265324_10000487 Ga0265324_1000048712 295
105 3300029957 Ga0265324_10000543 Ga0265324_100005435 295
106 3300029957 Ga0265324_10012395 Ga0265324_100123952 295
107 3300029957 Ga0265324_10026115 Ga0265324_100261152 295
108 3300029957 Ga0265324_10104290 Ga0265324_101042901 295
109 3300031247 Ga0265340_10001426 Ga0265340_100014262 295
110 3300031251 Ga0265327_10001087 Ga0265327_1000108727 295
111 3300031595 Ga0265313_10003469 Ga0265313_1000346914 295
112 3300034818 Ga0373950_0005522 Ga0373950_0005522_533_1432 295
113 3300035084 Ga0373928_0001431 Ga0373928_0001431_974_1873 295
114 3300035089 Ga0373944_0000150 Ga0373944_0000150_3355_4254 295
115 3300035090 Ga0373949_0002913 Ga0373949_0002913_1652_2551 295
116 3300035091 Ga0373951_0003636 Ga0373951_0003636_375_1274 295
117 3300035112 Ga0373932_0000005 Ga0373932_0000005_234730_235629 295
118 3300035118 Ga0373954_0028343 Ga0373954_0028343_123_1025 295
119 3300035119 Ga0373956_0005483 Ga0373956_0005483_3217_4119 295
120 3300035242 Ga0373962_0006398 Ga0373962_0006398_1306_2205 295
121 3300035691 Ga0373931_0000016 Ga0373931_0000016_23900_24799 295
122 3300035695 Ga0373927_0166304 Ga0373927_0166304_50_949 295
123 3300035724 Ga0373933_0314211 Ga0373933_0314211_68_970 295
124 3300036401 Ga0373937_0151287 Ga0373937_0151287_443_1345 295
125 3300037068 Ga0373925_0000485 Ga0373925_0000485_23784_24683 295
126 3300037068 Ga0373925_0015215 Ga0373925_0015215_877_1776 295
127 3300042876 Ga0451577_0023301 Ga0451577_0023301_1003_1899 295
128 3300044712 Ga0453684_0391199 Ga0453684_0391199_376_1275 295
129 3300045051 Ga0451576_0246987 Ga0451576_0246987_242_1141 295
130 3300045051 Ga0451576_0397234 Ga0451576_0397234_376_1272 295
131 3300046454 Ga0495592_0015043 Ga0495592_0015043_2152_3054 295
132 3300046459 Ga0495629_0111004 Ga0495629_0111004_638_1540 295
133 3300046516 Ga0495628_0167481 Ga0495628_0167481_243_1145 295
134 3300046517 Ga0495630_0044459 Ga0495630_0044459_1521_2420 295
135 3300046543 Ga0495645_0052460 Ga0495645_0052460_1160_2062 295
136 3300046559 Ga0495667_0017584 Ga0495667_0017584_2673_3596 295
137 3300046678 Ga0495599_0119948 Ga0495599_0119948_499_1401 295
138 3300047319 Ga0495674_0003764 Ga0495674_0003764_5064_5966 295
139 3300047319 Ga0495674_0166138 Ga0495674_0166138_310_1209 295
140 3300047322 Ga0495680_0331020 Ga0495680_0331020_20_922 295
141 3300047444 Ga0495675_0061542 Ga0495675_0061542_1079_1981 295
142 3300047471 Ga0495684_0016178 Ga0495684_0016178_4304_5206 295
143 3300048918 Ga0496115_0023021 Ga0496115_0023021_898_1785 295
144 3300049568 Ga0501031_0000039 Ga0501031_0000039_28956_29855 295
145 3300049568 Ga0501031_0140199 Ga0501031_0140199_90_989 295
146 3300049569 Ga0501032_0008417 Ga0501032_0008417_4260_5159 295
147 3300049570 Ga0501033_0002435 Ga0501033_0002435_14308_15207 295
148 3300049573 Ga0501037_0027628 Ga0501037_0027628_72_971 295
149 3300049581 Ga0501047_0049837 Ga0501047_0049837_386_1285 295
150 3300049823 Ga0501044_0000133 Ga0501044_0000133_50664_51563 295
151 3300049823 Ga0501044_0006544 Ga0501044_0006544_598_1497 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

10

246

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vlb-assembly2.cif.gz_B structure of unliganded arylmalonate decarboxylase 0.947 19 43
5h8i-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine 0.937 1 286
5h8l-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine 0.9353 1 286
5h8j-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.931 1 286
5h8l-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine 0.9267 1 286
ID Description Score Start End Superfamily
2zskB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.976 19 42 3.40.50.1860
5h8jC00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9203 1 286 3.60.110.10
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9194 1 290 3.60.110.10
6mg6B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9163 4 289 3.60.110.10
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8932 1 290 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A2V5VNZ9-F1-model_v4 Acyltransferase 0.9597 3 264 GO:0016746
GO:0033388
GO:0050126
AF-A0A5S3QQQ3-F1-model_v4 deleted 0.9597 5 110
AF-A0A7C6A220-F1-model_v4 Carbon-nitrogen hydrolase 0.9568 4 266 GO:0033388
GO:0050126
AF-A0A7V8SZN0-F1-model_v4 Carbon-nitrogen hydrolase 0.9542 7 257 GO:0033388
GO:0050126
AF-A0A534QKL7-F1-model_v4 Acyltransferase 0.9524 5 209 GO:0016746
GO:0033388
GO:0050126

Feature Viewer

pLDDT pTM Quality
87.51 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map