F210965

General Info

Members Datasets Scaffolds Average Seq Length
151 111 151 119

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100472980|Ga0070679_1004729801
Length 132
Sequence MLMKLLANENFPYKSIHYLKEKGYDVLSIGMDNPSILDSEIMKIAINEKRIIMTFDRDYGELIFRHNYKPEQGVIYLRLDKYQPHEPGLIIEEIITNKEINITRTLTVVDKNGIRKENINKPKSRRPKQLFG

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
83 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
84 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
85 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
109 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
110 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
111 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 2.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 0
Rhizosphere 98.01
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1022677 3300001915 Unclassified 972
2 JGI24740J21852_10007694 3300001979 Bacteria 4360
3 JGI25406J46586_10153772 3300003203 Bacteria 671
4 rootH1_10310275 3300003323 Bacteria 1151
5 Ga0070658_10044098 3300005327 Bacteria 3603
6 Ga0070658_11468801 3300005327 Unclassified 591
7 Ga0070683_100165863 3300005329 Unclassified 2095
8 Ga0070690_100970411 3300005330 Bacteria 668
9 Ga0070680_100019331 3300005336 Bacteria 5398
10 Ga0070680_100660265 3300005336 Bacteria 899
11 Ga0070682_100072725 3300005337 Bacteria 2204
12 Ga0070660_100009197 3300005339 Bacteria 6942
13 Ga0070689_100847818 3300005340 Bacteria 806
14 Ga0070687_100277925 3300005343 Bacteria 1053
15 Ga0070661_100045234 3300005344 Bacteria 3218
16 Ga0070669_100256835 3300005353 Unclassified 1393
17 Ga0070688_100466537 3300005365 Unclassified 947
18 Ga0070659_100275690 3300005366 Unclassified 1398
19 Ga0070663_100200173 3300005455 Unclassified 1558
20 Ga0070663_100753711 3300005455 Bacteria 831
21 Ga0070681_10058642 3300005458 Bacteria 3829
22 Ga0070681_10503560 3300005458 Unclassified 1124
23 Ga0070681_10586780 3300005458 Bacteria 1028
24 Ga0070685_10584281 3300005466 Bacteria 802
25 Ga0070707_100249829 3300005468 Bacteria 1726
26 Ga0070679_100038272 3300005530 Bacteria 4768
27 Ga0070679_100303034 3300005530 Unclassified 1548
28 Ga0070679_100472980 3300005530 Bacteria 1197
29 Ga0070684_100260163 3300005535 Bacteria 1587
30 Ga0068853_100175874 3300005539 Bacteria 1939
31 Ga0070686_100000249 3300005544 Bacteria 36831
32 Ga0070686_100389890 3300005544 Unclassified 1057
33 Ga0070696_100230844 3300005546 Unclassified 1392
34 Ga0068855_100083119 3300005563 Bacteria 3709
35 Ga0068855_100210442 3300005563 Bacteria 2185
36 Ga0068855_100236543 3300005563 Bacteria 2043
37 Ga0068857_100156608 3300005577 Bacteria 2066
38 Ga0068857_100209300 3300005577 Unclassified 1779
39 Ga0068854_100004637 3300005578 Bacteria 8673
40 Ga0068856_100009287 3300005614 Bacteria 9553
41 Ga0068852_100052918 3300005616 Bacteria 3492
42 Ga0068852_100700105 3300005616 Bacteria 1023
43 Ga0068859_100629192 3300005617 Bacteria 1166
44 Ga0068861_100149227 3300005719 Bacteria 1916
45 Ga0068860_100118212 3300005843 Unclassified 2537
46 Ga0081539_10092692 3300005985 Bacteria 1557
47 Ga0081539_10107894 3300005985 Bacteria 1407
48 Ga0097621_100570902 3300006237 Bacteria 1031
49 Ga0068871_100141216 3300006358 Archaea 2048
50 Ga0068871_101453879 3300006358 Unclassified 647
51 Ga0097620_100629251 3300006931 Bacteria 1166
52 Ga0105240_10232196 3300009093 Bacteria 2143
53 Ga0105245_10598982 3300009098 Bacteria 1128
54 Ga0105239_10329238 3300010375 Bacteria 1723
55 Ga0157373_10191317 3300013100 Bacteria 1442
56 Ga0157373_10355959 3300013100 Bacteria 1045
57 Ga0157371_10051631 3300013102 Bacteria 2921
58 Ga0157371_10268140 3300013102 Bacteria 1232
59 Ga0157370_10179317 3300013104 Bacteria 1968
60 Ga0157370_10717114 3300013104 Bacteria 912
61 Ga0157370_11794999 3300013104 Unclassified 550
62 Ga0157369_10002844 3300013105 Bacteria 20665
63 Ga0157369_10114451 3300013105 Bacteria 2864
64 Ga0157369_10489905 3300013105 Bacteria 1272
65 Ga0157369_11347191 3300013105 Unclassified 727
66 Ga0157374_11422846 3300013296 Unclassified 716
67 Ga0157378_10781322 3300013297 Unclassified 980
68 Ga0157372_10024748 3300013307 Bacteria 6524
69 Ga0157372_10126988 3300013307 Bacteria 2933
70 Ga0157372_10319363 3300013307 Bacteria 1808
71 Ga0157372_10496657 3300013307 Bacteria 1423
72 Ga0157372_10863187 3300013307 Bacteria 1050
73 Ga0157372_11622554 3300013307 Bacteria 744
74 Ga0157372_12293252 3300013307 Unclassified 620
75 Ga0157375_10000029 3300013308 Bacteria 199310
76 Ga0157375_13778589 3300013308 Bacteria 503
77 Ga0157380_10941354 3300014326 Bacteria 893
78 Ga0157376_10137098 3300014969 Bacteria 2191
79 Ga0206350_10176445 3300020080 Bacteria 2123
80 Ga0206354_11358936 3300020081 Unclassified 1509
81 Ga0154015_1061297 3300020610 Unclassified 1364
82 Ga0207647_10035950 3300025904 Bacteria 3151
83 Ga0207705_10005736 3300025909 Bacteria 9268
84 Ga0207707_10006752 3300025912 Bacteria 10019
85 Ga0207695_10102026 3300025913 Bacteria 2863
86 Ga0207660_10047934 3300025917 Bacteria 3023
87 Ga0207660_10601046 3300025917 Bacteria 896
88 Ga0207660_10819072 3300025917 Bacteria 760
89 Ga0207662_10388609 3300025918 Bacteria 944
90 Ga0207657_10006669 3300025919 Bacteria 11942
91 Ga0207649_10194799 3300025920 Unclassified 1427
92 Ga0207652_10005993 3300025921 Bacteria 9834
93 Ga0207687_10536053 3300025927 Bacteria 980
94 Ga0207644_11122455 3300025931 Bacteria 661
95 Ga0207690_10625095 3300025932 Unclassified 881
96 Ga0207661_10605803 3300025944 Bacteria 1005
97 Ga0207667_10012415 3300025949 Bacteria 9819
98 Ga0207667_10196432 3300025949 Bacteria 2070
99 Ga0207667_10200315 3300025949 Bacteria 2048
100 Ga0207640_10002345 3300025981 Bacteria 10171
101 Ga0207639_10033374 3300026041 Bacteria 3797
102 Ga0207678_10076628 3300026067 Bacteria 2864
103 Ga0207702_10006689 3300026078 Bacteria 9906
104 Ga0207674_10077980 3300026116 Bacteria 3318
105 Ga0207675_101238039 3300026118 Bacteria 767
106 Ga0207698_10049175 3300026142 Bacteria 3207
107 Ga0207698_10139219 3300026142 Bacteria 2088
108 Ga0268264_10324130 3300028381 Bacteria 1458
109 Ga0265338_10171257 3300028800 Bacteria 1665
110 Ga0265760_10022731 3300031090 Bacteria 1818
111 Ga0265332_10257990 3300031238 Unclassified 721
112 Ga0265331_10335489 3300031250 Bacteria 677
113 Ga0265316_10275242 3300031344 Unclassified 1231
114 Ga0307409_100982882 3300031995 Unclassified 861
115 Ga0373959_0000184 3300034820 Bacteria 13927
116 Ga0373941_0521140 3300035115 Unclassified 508
117 Ga0373953_0273900 3300035117 Unclassified 735
118 Ga0373957_0142342 3300035120 Bacteria 981
119 Ga0373947_0296612 3300035725 Bacteria 1077
120 Ga0316582_0032270 3300036647 Bacteria 3208
121 Ga0395899_0031328 3300037312 Bacteria 3997
122 Ga0395900_0479855 3300037418 Bacteria 1196
123 Ga0395898_0071389 3300037466 Bacteria 3355
124 Ga0395905_0079421 3300037471 Bacteria 3075
125 Ga0395901_0020963 3300038443 Bacteria 6696
126 Ga0451577_0008611 3300042876 Bacteria 9919
127 Ga0451577_0471280 3300042876 Unclassified 1140
128 Ga0451577_1333118 3300042876 Bacteria 638
129 Ga0453683_0054454 3300044673 Bacteria 2503
130 Ga0453683_0383116 3300044673 Bacteria 905
131 Ga0453684_0000226 3300044712 Bacteria 244912
132 Ga0453684_0001022 3300044712 Bacteria 89958
133 Ga0453684_2005696 3300044712 Unclassified 583
134 Ga0451576_0001055 3300045051 Bacteria 50745
135 Ga0495592_0493143 3300046454 Unclassified 761
136 Ga0495580_0001987 3300046472 Bacteria 17988
137 Ga0495664_0060085 3300046477 Bacteria 2263
138 Ga0495666_0495858 3300046526 Bacteria 546
139 Ga0495640_0365221 3300046533 Unclassified 889
140 Ga0495635_0621932 3300046663 Unclassified 704
141 Ga0495635_0864518 3300046663 Unclassified 580
142 Ga0495599_0169871 3300046678 Bacteria 1346
143 Ga0495674_0052156 3300047319 Bacteria 3601
144 Ga0501032_0014258 3300049569 Bacteria 5630
145 Ga0501034_0004792 3300049571 Bacteria 14959
146 Ga0501034_0034129 3300049571 Bacteria 5158
147 Ga0501039_1259983 3300049575 Unclassified 571
148 Ga0501257_000961 3300049686 Bacteria 5799
149 Ga0495601_0217153 3300053077 Unclassified 1249
150 Ga0500646_0010993 3300053090 Bacteria 2325
151 Ga0500628_000282 3300053129 Bacteria 9671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_11422846 Ga0157374_114228462 94
2 3300005563 Ga0068855_100083119 Ga0068855_1000831195 99
3 3300013307 Ga0157372_10319363 Ga0157372_103193632 99
4 3300025949 Ga0207667_10200315 Ga0207667_102003154 99
5 3300006237 Ga0097621_100570902 Ga0097621_1005709022 114
6 3300006358 Ga0068871_100141216 Ga0068871_1001412162 114
7 3300013105 Ga0157369_10002844 Ga0157369_100028445 114
8 3300013308 Ga0157375_10000029 Ga0157375_10000029126 114
9 3300013308 Ga0157375_13778589 Ga0157375_137785891 114
10 3300035115 Ga0373941_0521140 Ga0373941_0521140_141_488 114
11 3300009098 Ga0105245_10598982 Ga0105245_105989822 115
12 3300025927 Ga0207687_10536053 Ga0207687_105360532 115
13 3300049569 Ga0501032_0014258 Ga0501032_0014258_3044_3394 115
14 3300049575 Ga0501039_1259983 Ga0501039_1259983_109_459 115
15 3300003323 rootH1_10310275 rootH1_103102752 116
16 3300005327 Ga0070658_11468801 Ga0070658_114688012 116
17 3300005330 Ga0070690_100970411 Ga0070690_1009704112 116
18 3300005340 Ga0070689_100847818 Ga0070689_1008478181 116
19 3300005343 Ga0070687_100277925 Ga0070687_1002779251 116
20 3300005353 Ga0070669_100256835 Ga0070669_1002568351 116
21 3300005365 Ga0070688_100466537 Ga0070688_1004665373 116
22 3300005466 Ga0070685_10584281 Ga0070685_105842812 116
23 3300005544 Ga0070686_100389890 Ga0070686_1003898902 116
24 3300005616 Ga0068852_100700105 Ga0068852_1007001052 116
25 3300005719 Ga0068861_100149227 Ga0068861_1001492272 116
26 3300005843 Ga0068860_100118212 Ga0068860_1001182123 116
27 3300010375 Ga0105239_10329238 Ga0105239_103292382 116
28 3300013100 Ga0157373_10191317 Ga0157373_101913173 116
29 3300013104 Ga0157370_11794999 Ga0157370_117949991 116
30 3300013105 Ga0157369_10489905 Ga0157369_104899052 116
31 3300013307 Ga0157372_12293252 Ga0157372_122932522 116
32 3300025918 Ga0207662_10388609 Ga0207662_103886091 116
33 3300025931 Ga0207644_11122455 Ga0207644_111224552 116
34 3300026118 Ga0207675_101238039 Ga0207675_1012380392 116
35 3300026142 Ga0207698_10139219 Ga0207698_101392192 116
36 3300028381 Ga0268264_10324130 Ga0268264_103241303 116
37 3300031238 Ga0265332_10257990 Ga0265332_102579901 116
38 3300031250 Ga0265331_10335489 Ga0265331_103354891 116
39 3300036647 Ga0316582_0032270 Ga0316582_0032270_1120_1473 116
40 3300037418 Ga0395900_0479855 Ga0395900_0479855_542_895 116
41 3300042876 Ga0451577_0008611 Ga0451577_0008611_1267_1620 116
42 3300042876 Ga0451577_1333118 Ga0451577_1333118_245_601 116
43 3300044673 Ga0453683_0383116 Ga0453683_0383116_293_646 116
44 3300044712 Ga0453684_0001022 Ga0453684_0001022_32775_33128 116
45 3300045051 Ga0451576_0001055 Ga0451576_0001055_45625_45978 116
46 3300049571 Ga0501034_0004792 Ga0501034_0004792_5529_5882 116
47 3300053090 Ga0500646_0010993 Ga0500646_0010993_181_534 116
48 3300003203 JGI25406J46586_10153772 JGI25406J46586_101537721 117
49 3300005336 Ga0070680_100660265 Ga0070680_1006602652 117
50 3300005455 Ga0070663_100753711 Ga0070663_1007537113 117
51 3300005458 Ga0070681_10503560 Ga0070681_105035601 117
52 3300005458 Ga0070681_10586780 Ga0070681_105867802 117
53 3300005468 Ga0070707_100249829 Ga0070707_1002498291 117
54 3300005544 Ga0070686_100000249 Ga0070686_10000024912 117
55 3300005985 Ga0081539_10092692 Ga0081539_100926923 117
56 3300005985 Ga0081539_10107894 Ga0081539_101078942 117
57 3300013307 Ga0157372_10126988 Ga0157372_101269883 117
58 3300025917 Ga0207660_10601046 Ga0207660_106010461 117
59 3300028800 Ga0265338_10171257 Ga0265338_101712572 117
60 3300031344 Ga0265316_10275242 Ga0265316_102752421 117
61 3300035117 Ga0373953_0273900 Ga0373953_0273900_264_620 117
62 3300037466 Ga0395898_0071389 Ga0395898_0071389_2478_2834 117
63 3300044673 Ga0453683_0054454 Ga0453683_0054454_1349_1705 117
64 3300044712 Ga0453684_0000226 Ga0453684_0000226_3074_3430 117
65 3300046663 Ga0495635_0621932 Ga0495635_0621932_179_535 117
66 3300049571 Ga0501034_0034129 Ga0501034_0034129_1035_1394 117
67 3300049686 Ga0501257_000961 Ga0501257_000961_2686_3042 117
68 3300053077 Ga0495601_0217153 Ga0495601_0217153_378_734 117
69 3300005530 Ga0070679_100038272 Ga0070679_1000382721 118
70 3300005563 Ga0068855_100236543 Ga0068855_1002365434 118
71 3300005617 Ga0068859_100629192 Ga0068859_1006291921 118
72 3300006358 Ga0068871_101453879 Ga0068871_1014538791 118
73 3300006931 Ga0097620_100629251 Ga0097620_1006292511 118
74 3300013102 Ga0157371_10268140 Ga0157371_102681402 118
75 3300013104 Ga0157370_10717114 Ga0157370_107171142 118
76 3300013105 Ga0157369_11347191 Ga0157369_113471911 118
77 3300013297 Ga0157378_10781322 Ga0157378_107813221 118
78 3300013307 Ga0157372_10496657 Ga0157372_104966572 118
79 3300013307 Ga0157372_10863187 Ga0157372_108631872 118
80 3300014326 Ga0157380_10941354 Ga0157380_109413541 118
81 3300014969 Ga0157376_10137098 Ga0157376_101370983 118
82 3300025917 Ga0207660_10819072 Ga0207660_108190721 118
83 3300025949 Ga0207667_10196432 Ga0207667_101964324 118
84 3300031090 Ga0265760_10022731 Ga0265760_100227314 118
85 3300031995 Ga0307409_100982882 Ga0307409_1009828821 118
86 3300034820 Ga0373959_0000184 Ga0373959_0000184_12704_13063 118
87 3300035120 Ga0373957_0142342 Ga0373957_0142342_424_792 118
88 3300035725 Ga0373947_0296612 Ga0373947_0296612_379_747 118
89 3300037312 Ga0395899_0031328 Ga0395899_0031328_2284_2643 118
90 3300037471 Ga0395905_0079421 Ga0395905_0079421_486_845 118
91 3300038443 Ga0395901_0020963 Ga0395901_0020963_3750_4109 118
92 3300042876 Ga0451577_0471280 Ga0451577_0471280_325_717 118
93 3300044712 Ga0453684_2005696 Ga0453684_2005696_101_463 118
94 3300046454 Ga0495592_0493143 Ga0495592_0493143_232_600 118
95 3300046472 Ga0495580_0001987 Ga0495580_0001987_1065_1433 118
96 3300046477 Ga0495664_0060085 Ga0495664_0060085_576_944 118
97 3300046526 Ga0495666_0495858 Ga0495666_0495858_79_447 118
98 3300046533 Ga0495640_0365221 Ga0495640_0365221_140_508 118
99 3300046663 Ga0495635_0864518 Ga0495635_0864518_21_389 118
100 3300046678 Ga0495599_0169871 Ga0495599_0169871_588_956 118
101 3300047319 Ga0495674_0052156 Ga0495674_0052156_1850_2218 118
102 3300053129 Ga0500628_000282 Ga0500628_000282_5201_5566 118
103 3300001915 JGI24741J21665_1022677 JGI24741J21665_10226772 119
104 3300001979 JGI24740J21852_10007694 JGI24740J21852_100076944 119
105 3300005327 Ga0070658_10044098 Ga0070658_100440984 119
106 3300005329 Ga0070683_100165863 Ga0070683_1001658633 119
107 3300005336 Ga0070680_100019331 Ga0070680_1000193315 119
108 3300005337 Ga0070682_100072725 Ga0070682_1000727252 119
109 3300005339 Ga0070660_100009197 Ga0070660_1000091975 119
110 3300005344 Ga0070661_100045234 Ga0070661_1000452344 119
111 3300005366 Ga0070659_100275690 Ga0070659_1002756902 119
112 3300005455 Ga0070663_100200173 Ga0070663_1002001732 119
113 3300005458 Ga0070681_10058642 Ga0070681_100586424 119
114 3300005530 Ga0070679_100303034 Ga0070679_1003030342 119
115 3300005530 Ga0070679_100472980 Ga0070679_1004729801 119
116 3300005535 Ga0070684_100260163 Ga0070684_1002601633 119
117 3300005539 Ga0068853_100175874 Ga0068853_1001758743 119
118 3300005546 Ga0070696_100230844 Ga0070696_1002308442 119
119 3300005563 Ga0068855_100210442 Ga0068855_1002104422 119
120 3300005577 Ga0068857_100156608 Ga0068857_1001566084 119
121 3300005577 Ga0068857_100209300 Ga0068857_1002093003 119
122 3300005578 Ga0068854_100004637 Ga0068854_1000046374 119
123 3300005614 Ga0068856_100009287 Ga0068856_1000092874 119
124 3300005616 Ga0068852_100052918 Ga0068852_1000529182 119
125 3300009093 Ga0105240_10232196 Ga0105240_102321963 119
126 3300013100 Ga0157373_10355959 Ga0157373_103559591 119
127 3300013102 Ga0157371_10051631 Ga0157371_100516314 119
128 3300013104 Ga0157370_10179317 Ga0157370_101793173 119
129 3300013105 Ga0157369_10114451 Ga0157369_101144514 119
130 3300013307 Ga0157372_10024748 Ga0157372_100247486 119
131 3300013307 Ga0157372_11622554 Ga0157372_116225541 119
132 3300020080 Ga0206350_10176445 Ga0206350_101764454 119
133 3300020081 Ga0206354_11358936 Ga0206354_113589363 119
134 3300020610 Ga0154015_1061297 Ga0154015_10612973 119
135 3300025904 Ga0207647_10035950 Ga0207647_100359504 119
136 3300025909 Ga0207705_10005736 Ga0207705_100057364 119
137 3300025912 Ga0207707_10006752 Ga0207707_100067524 119
138 3300025913 Ga0207695_10102026 Ga0207695_101020264 119
139 3300025917 Ga0207660_10047934 Ga0207660_100479342 119
140 3300025919 Ga0207657_10006669 Ga0207657_100066697 119
141 3300025920 Ga0207649_10194799 Ga0207649_101947991 119
142 3300025921 Ga0207652_10005993 Ga0207652_100059937 119
143 3300025932 Ga0207690_10625095 Ga0207690_106250951 119
144 3300025944 Ga0207661_10605803 Ga0207661_106058032 119
145 3300025949 Ga0207667_10012415 Ga0207667_100124157 119
146 3300025981 Ga0207640_10002345 Ga0207640_100023454 119
147 3300026041 Ga0207639_10033374 Ga0207639_100333743 119
148 3300026067 Ga0207678_10076628 Ga0207678_100766282 119
149 3300026078 Ga0207702_10006689 Ga0207702_100066898 119
150 3300026116 Ga0207674_10077980 Ga0207674_100779803 119
151 3300026142 Ga0207698_10049175 Ga0207698_100491754 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18480

DUF5615

Domain of unknown function (DUF5615)

3

112

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gju-assembly2.cif.gz_H crystal structure of human methylmalonyl-coa mutase (mmut) in complex with methylmalonic acidemia type a protein (mmaa), coenzyme a, and gdp 0.6575 2 99
7dkm-assembly1.cif.gz_A phgdh covalently linked to oridonin 0.6048 2 75
2ekl-assembly1.cif.gz_A-2 structure of st1218 protein from sulfolobus tokodaii 0.6038 2 73
3gi1-assembly2.cif.gz_B crystal structure of the laminin-binding protein lbp of streptococcus pyogenes 0.5716 1 56
8gju-assembly2.cif.gz_H crystal structure of human methylmalonyl-coa mutase (mmut) in complex with methylmalonic acidemia type a protein (mmaa), coenzyme a, and gdp 0.559 2 99
ID Description Score Start End Superfamily
3gi1B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.6075 1 56 3.40.50.1980
4rkrD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6016 1 101 3.40.50.2300
3hg7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.5809 1 99 3.40.50.720
3e61A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.5755 1 94 3.40.50.2300
af_O53182_522_626_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.5668 1 94 3.40.50.920
ID Description Score Start End GO Terms
AF-A0A6B0WVL9-F1-model_v4 DUF5615 domain-containing protein 0.9861 3 70
AF-A0A1A8Y0M4-F1-model_v4 DUF5615 domain-containing protein 0.9837 1 118
AF-T1BRE4-F1-model_v4 DUF5615 domain-containing protein 0.9829 6 80
AF-A0A4R3JSF4-F1-model_v4 Putative nuclease of predicted toxin-antitoxin system 0.9796 3 119
AF-A0A450Y3S3-F1-model_v4 DUF5615 domain-containing protein 0.9789 3 96

Feature Viewer

pLDDT pTM Quality
95.41 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map