F209903

General Info

Members Datasets Scaffolds Average Seq Length
150 104 300 163

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0024576|Ga0501047_0024576_2783_3352
Length 189
Sequence VRGTLCNIELSSSAISLFRGFEMGSPLHNPKLLSLEAAVARRRELAAAGKRVVLTNGVFDLLHAGHVYFLQAARAQGDALFVALNASESVRQLKGPTRPVVDTPERAYCLGSLSCVDAVVVFGTPRLDAEIRALRPDVYCKAGDYTLEKLDAGERAALQQAGTRIEFLPFLPGFSTTSLIARIKAAGEI

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
62 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
63 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
83 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
91 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.67
Stem 0
Stem Tuber 0
Unclassified 16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0024576 3300049581 Bacteria 5783
2 rootH2_10183061 3300003320 Bacteria 7998
3 rootL2_10120665 3300003322 Bacteria 3136
4 Ga0070658_10265634 3300005327 Bacteria 1458
5 Ga0070676_10148511 3300005328 Unclassified 1498
6 Ga0070677_10074505 3300005333 Bacteria 1436
7 Ga0070692_10001679 3300005345 Bacteria 8192
8 Ga0070673_100243367 3300005364 Bacteria 1565
9 Ga0070701_10054802 3300005438 Bacteria 2080
10 Ga0070711_101308499 3300005439 Bacteria 629
11 Ga0070705_100624764 3300005440 Bacteria 836
12 Ga0070694_100057205 3300005444 Bacteria 2650
13 Ga0070694_100798050 3300005444 Bacteria 774
14 Ga0070681_11104037 3300005458 Bacteria 714
15 Ga0070698_101132443 3300005471 Bacteria 731
16 Ga0070699_100106744 3300005518 Bacteria 2457
17 Ga0070699_100276611 3300005518 Bacteria 1503
18 Ga0070679_100028620 3300005530 Bacteria 5495
19 Ga0070684_100238208 3300005535 Bacteria 1662
20 Ga0070695_100111850 3300005545 Bacteria 1854
21 Ga0070696_100024591 3300005546 Bacteria 4094
22 Ga0070704_100054718 3300005549 Bacteria 2825
23 Ga0070704_100171466 3300005549 Bacteria 1726
24 Ga0070704_100210518 3300005549 Bacteria 1575
25 Ga0068855_100424788 3300005563 Bacteria 1453
26 Ga0068857_100020981 3300005577 Bacteria 5748
27 Ga0068857_100037428 3300005577 Bacteria 4298
28 Ga0068857_100497149 3300005577 Bacteria 1144
29 Ga0068856_100001531 3300005614 Bacteria 24224
30 Ga0070702_100215692 3300005615 Bacteria 1280
31 Ga0068864_101955029 3300005618 Bacteria 592
32 Ga0070717_10001137 3300006028 Bacteria 17980
33 Ga0075428_100253913 3300006844 Bacteria 1894
34 Ga0075428_100813127 3300006844 Bacteria 993
35 Ga0075430_100339007 3300006846 Bacteria 1242
36 Ga0075431_100047339 3300006847 Bacteria 4433
37 Ga0075433_10005144 3300006852 Bacteria 10261
38 Ga0075434_100128437 3300006871 Bacteria 2552
39 Ga0075429_100508899 3300006880 Bacteria 1055
40 Ga0068865_100769462 3300006881 Bacteria 828
41 Ga0075435_100884954 3300007076 Unclassified 778
42 Ga0105240_10794318 3300009093 Bacteria 1026
43 Ga0105243_10159944 3300009148 Bacteria 1941
44 Ga0105237_11098879 3300009545 Bacteria 802
45 Ga0105238_10094303 3300009551 Bacteria 2981
46 Ga0105249_10257414 3300009553 Bacteria 1733
47 Ga0105246_11046718 3300011119 Bacteria 742
48 Ga0157370_10251070 3300013104 Unclassified 1636
49 Ga0157372_10006972 3300013307 Bacteria 12031
50 Ga0163163_10235275 3300014325 Unclassified 1881
51 Ga0213875_10034160 3300021388 Bacteria 2401
52 Ga0207645_10706921 3300025907 Unclassified 685
53 Ga0207705_10195572 3300025909 Bacteria 1531
54 Ga0207707_10823581 3300025912 Bacteria 772
55 Ga0207695_11294193 3300025913 Unclassified 609
56 Ga0207694_10067772 3300025924 Bacteria 2786
57 Ga0207669_10007871 3300025937 Bacteria 4966
58 Ga0207661_10906148 3300025944 Bacteria 812
59 Ga0207667_10363822 3300025949 Bacteria 1475
60 Ga0207651_10081571 3300025960 Bacteria 2332
61 Ga0207708_11191861 3300026075 Unclassified 666
62 Ga0207702_10001191 3300026078 Bacteria 26401
63 Ga0207676_11769637 3300026095 Bacteria 616
64 Ga0207674_10035536 3300026116 Bacteria 5200
65 Ga0207674_10075731 3300026116 Bacteria 3374
66 Ga0265337_1094575 3300028556 Unclassified 814
67 Ga0265319_1003846 3300028563 Bacteria 7682
68 Ga0265319_1009728 3300028563 Bacteria 4066
69 Ga0265319_1077984 3300028563 Bacteria 1055
70 Ga0265319_1102150 3300028563 Bacteria 900
71 Ga0265318_10018079 3300028577 Bacteria 2883
72 Ga0265318_10036002 3300028577 Bacteria 1901
73 Ga0265323_10000387 3300028653 Bacteria 25382
74 Ga0265323_10001967 3300028653 Bacteria 9682
75 Ga0265323_10013927 3300028653 Bacteria 3196
76 Ga0265323_10034803 3300028653 Bacteria 1859
77 Ga0265323_10077181 3300028653 Unclassified 1129
78 Ga0265323_10090302 3300028653 Unclassified 1024
79 Ga0265323_10142238 3300028653 Bacteria 771
80 Ga0265322_10002279 3300028654 Bacteria 5942
81 Ga0265322_10005863 3300028654 Bacteria 3623
82 Ga0265330_10005843 3300031235 Bacteria 6106
83 Ga0265320_10001034 3300031240 Bacteria 20687
84 Ga0265320_10007138 3300031240 Bacteria 6965
85 Ga0265320_10049195 3300031240 Bacteria 2053
86 Ga0265339_10238299 3300031249 Unclassified 884
87 Ga0265331_10196498 3300031250 Bacteria 909
88 Ga0265327_10006032 3300031251 Bacteria 9832
89 Ga0265327_10070108 3300031251 Bacteria 1757
90 Ga0265327_10296987 3300031251 Unclassified 712
91 Ga0265316_10014295 3300031344 Bacteria 6993
92 Ga0265316_10022793 3300031344 Bacteria 5270
93 Ga0265316_10057907 3300031344 Bacteria 3020
94 Ga0265316_10113639 3300031344 Bacteria 2049
95 Ga0265316_10350913 3300031344 Unclassified 1068
96 Ga0265316_10528160 3300031344 Bacteria 841
97 Ga0265314_10030718 3300031711 Bacteria 3973
98 Ga0265314_10147638 3300031711 Bacteria 1446
99 Ga0265314_10188836 3300031711 Bacteria 1228
100 Ga0265342_10004536 3300031712 Bacteria 10889
101 Ga0265342_10097046 3300031712 Unclassified 1683
102 Ga0307406_11272010 3300031901 Bacteria 641
103 Ga0436364_1313014 3300037853 Bacteria 2753
104 Ga0451577_0060815 3300042876 Bacteria 3368
105 Ga0451577_0278604 3300042876 Bacteria 1515
106 Ga0453684_0023976 3300044712 Bacteria 8947
107 Ga0453684_0146836 3300044712 Bacteria 2808
108 Ga0453684_0432239 3300044712 Bacteria 1468
109 Ga0466971_0090063 3300044719 Unclassified 1404
110 Ga0466970_0518012 3300044765 Bacteria 688
111 Ga0466957_0186699 3300044842 Bacteria 1356
112 Ga0466960_0028979 3300044901 Bacteria 2537
113 Ga0466959_0047283 3300045049 Bacteria 3165
114 Ga0451576_0049466 3300045051 Bacteria 4411
115 Ga0451576_2035560 3300045051 Unclassified 591
116 Ga0466967_0152784 3300045976 Bacteria 2159
117 Ga0466967_0298290 3300045976 Bacteria 1550
118 Ga0495611_0172761 3300046648 Unclassified 1010
119 Ga0495636_0298388 3300047318 Unclassified 753
120 Ga0501033_0001582 3300049570 Bacteria 20025
121 Ga0501037_0227425 3300049573 Unclassified 1310
122 Ga0501038_0490668 3300049574 Unclassified 940
123 Ga0501039_0603595 3300049575 Bacteria 860
124 Ga0501046_0005695 3300049580 Bacteria 11118
125 Ga0501047_0020229 3300049581 Bacteria 6392
126 Ga0501047_0187908 3300049581 Bacteria 1930
127 Ga0501047_1082691 3300049581 Unclassified 615
128 Ga0501048_0133329 3300049582 Bacteria 1755
129 Ga0501070_0191306 3300049586 Bacteria 1682
130 Ga0501243_000256 3300049675 Bacteria 6759
131 Ga0501080_0251552 3300049742 Unclassified 1611
132 Ga0501083_0001207 3300049744 Bacteria 17492
133 Ga0501083_0002017 3300049744 Bacteria 13968
134 Ga0501083_0096537 3300049744 Bacteria 1950
135 Ga0501035_0003775 3300049822 Bacteria 14435
136 Ga0501035_0137838 3300049822 Bacteria 2123
137 Ga0501035_0415487 3300049822 Bacteria 1117
138 Ga0501035_0541014 3300049822 Unclassified 955
139 Ga0501044_0001980 3300049823 Bacteria 23675
140 Ga0501044_0100868 3300049823 Bacteria 2904
141 nmdc:mga05p37_88576_c1 3300050507 Bacteria 3815
142 nmdc:mga09592_1060837_c1 3300050508 Bacteria 675
143 nmdc:mga0qj67_537414_c1 3300050509 Bacteria 938
144 nmdc:mga0qj67_809162_c1 3300050509 Bacteria 741
145 nmdc:mga06r32_217093_c1 3300050510 Bacteria 1900
146 nmdc:mga0rr50_94991_c1 3300050513 Unclassified 2329
147 nmdc:mga0a205_6180_c1 3300050515 Bacteria 10808
148 Ga0501084_0308402 3300054114 Bacteria 1337
149 Ga0501082_0251484 3300060353 Bacteria 1538
150 2788432974 2786546940 Bacteria 6396474
151 Ga0501047_0024576
152 rootH2_10183061
153 rootL2_10120665
154 Ga0070658_10265634
155 Ga0070676_10148511
156 Ga0070677_10074505
157 Ga0070692_10001679
158 Ga0070673_100243367
159 Ga0070701_10054802
160 Ga0070711_101308499
161 Ga0070705_100624764
162 Ga0070694_100057205
163 Ga0070694_100798050
164 Ga0070681_11104037
165 Ga0070698_101132443
166 Ga0070699_100106744
167 Ga0070699_100276611
168 Ga0070679_100028620
169 Ga0070684_100238208
170 Ga0070695_100111850
171 Ga0070696_100024591
172 Ga0070704_100054718
173 Ga0070704_100171466
174 Ga0070704_100210518
175 Ga0068855_100424788
176 Ga0068857_100020981
177 Ga0068857_100037428
178 Ga0068857_100497149
179 Ga0068856_100001531
180 Ga0070702_100215692
181 Ga0068864_101955029
182 Ga0070717_10001137
183 Ga0075428_100253913
184 Ga0075428_100813127
185 Ga0075430_100339007
186 Ga0075431_100047339
187 Ga0075433_10005144
188 Ga0075434_100128437
189 Ga0075429_100508899
190 Ga0068865_100769462
191 Ga0075435_100884954
192 Ga0105240_10794318
193 Ga0105243_10159944
194 Ga0105237_11098879
195 Ga0105238_10094303
196 Ga0105249_10257414
197 Ga0105246_11046718
198 Ga0157370_10251070
199 Ga0157372_10006972
200 Ga0163163_10235275
201 Ga0213875_10034160
202 Ga0207645_10706921
203 Ga0207705_10195572
204 Ga0207707_10823581
205 Ga0207695_11294193
206 Ga0207694_10067772
207 Ga0207669_10007871
208 Ga0207661_10906148
209 Ga0207667_10363822
210 Ga0207651_10081571
211 Ga0207708_11191861
212 Ga0207702_10001191
213 Ga0207676_11769637
214 Ga0207674_10035536
215 Ga0207674_10075731
216 Ga0265337_1094575
217 Ga0265319_1003846
218 Ga0265319_1009728
219 Ga0265319_1077984
220 Ga0265319_1102150
221 Ga0265318_10018079
222 Ga0265318_10036002
223 Ga0265323_10000387
224 Ga0265323_10001967
225 Ga0265323_10013927
226 Ga0265323_10034803
227 Ga0265323_10077181
228 Ga0265323_10090302
229 Ga0265323_10142238
230 Ga0265322_10002279
231 Ga0265322_10005863
232 Ga0265330_10005843
233 Ga0265320_10001034
234 Ga0265320_10007138
235 Ga0265320_10049195
236 Ga0265339_10238299
237 Ga0265331_10196498
238 Ga0265327_10006032
239 Ga0265327_10070108
240 Ga0265327_10296987
241 Ga0265316_10014295
242 Ga0265316_10022793
243 Ga0265316_10057907
244 Ga0265316_10113639
245 Ga0265316_10350913
246 Ga0265316_10528160
247 Ga0265314_10030718
248 Ga0265314_10147638
249 Ga0265314_10188836
250 Ga0265342_10004536
251 Ga0265342_10097046
252 Ga0307406_11272010
253 Ga0436364_1313014
254 Ga0451577_0060815
255 Ga0451577_0278604
256 Ga0453684_0023976
257 Ga0453684_0146836
258 Ga0453684_0432239
259 Ga0466971_0090063
260 Ga0466970_0518012
261 Ga0466957_0186699
262 Ga0466960_0028979
263 Ga0466959_0047283
264 Ga0451576_0049466
265 Ga0451576_2035560
266 Ga0466967_0152784
267 Ga0466967_0298290
268 Ga0495611_0172761
269 Ga0495636_0298388
270 Ga0501033_0001582
271 Ga0501037_0227425
272 Ga0501038_0490668
273 Ga0501039_0603595
274 Ga0501046_0005695
275 Ga0501047_0020229
276 Ga0501047_0187908
277 Ga0501047_1082691
278 Ga0501048_0133329
279 Ga0501070_0191306
280 Ga0501243_000256
281 Ga0501080_0251552
282 Ga0501083_0001207
283 Ga0501083_0002017
284 Ga0501083_0096537
285 Ga0501035_0003775
286 Ga0501035_0137838
287 Ga0501035_0415487
288 Ga0501035_0541014
289 Ga0501044_0001980
290 Ga0501044_0100868
291 nmdc:mga05p37_88576_c1
292 nmdc:mga09592_1060837_c1
293 nmdc:mga0qj67_537414_c1
294 nmdc:mga0qj67_809162_c1
295 nmdc:mga06r32_217093_c1
296 nmdc:mga0rr50_94991_c1
297 nmdc:mga0a205_6180_c1
298 Ga0501084_0308402
299 Ga0501082_0251484
300 2788432974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

54

182

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.9267 6 144
1n1d-assembly1.cif.gz_A glycerol-3-phosphate cytidylyltransferase complexed with cdp-glycerol 0.8809 26 157
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.8769 6 144
1n1d-assembly1.cif.gz_A glycerol-3-phosphate cytidylyltransferase complexed with cdp-glycerol 0.8615 26 157
5x9q-assembly1.cif.gz_B crystal structure of hldc from burkholderia pseudomallei 0.8603 6 162
ID Description Score Start End Superfamily
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.953 7 161 3.40.50.620
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9238 7 161 3.40.50.620
1cozA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8859 26 157 3.40.50.620
1cozA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8663 26 157 3.40.50.620
af_Q18524_184_340_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8367 25 161 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A820G945-F1-model_v4 Cytidyltransferase-like domain-containing protein 0.9898 6 114 GO:0003824
GO:0009058
AF-A0A2N2L489-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase 0.9897 6 114 GO:0009058
GO:0016779
AF-A0A3D5UB32-F1-model_v4 Bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase 0.9893 6 114 GO:0009058
GO:0016301
AF-A0A7Y3D7N4-F1-model_v4 Adenylyltransferase/cytidyltransferase family protein 0.9893 5 116 GO:0009058
GO:0016779
AF-A0A7V4WAQ9-F1-model_v4 Bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase 0.9878 6 116 GO:0009058
GO:0016301

Map