F209842

General Info

Members Datasets Scaffolds Average Seq Length
150 94 300 257

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0001972|Ga0501031_0001972_7966_8835
Length 289
Sequence MVAAAIGLALALAFAPLDAAPAAQGDRPDLLVFAAASLQTALDELTPQVEAATGVQLRASYAASSTLARQIENGAPADLFISADLDWMDYLAARSLIQPGTRVDLLGNHLVLIAPAGEPSTLRIAPGFPLAAALGVNGRLAIADPDAVPAGKYARAALTALGVWDSVAGRLARAENVRAALLLVERGEVPLGIVYRTDAAVDPGVTVVSRFPDATHPPIVYPAALTRSARAGAARVLAFLQGPEASAVFDRWGFETKKQGPGPASPXXXXTSAVWRRTSALPLFLRNRQ

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
16 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
17 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
20 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
21 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
22 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
31 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
32 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
33 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
34 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
35 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
40 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
41 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
42 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
43 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
44 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
45 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
46 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
47 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
48 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
49 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
50 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
51 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
52 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
53 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
54 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
55 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
67 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
68 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
69 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
70 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
71 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
72 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
73 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
74 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
75 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
76 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
77 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
78 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
81 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
82 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
83 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
84 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
85 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
86 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
87 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
88 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
89 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
90 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
91 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
92 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
93 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
94 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 0
Isolates 4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0
Rhizoplane 4
Rhizosphere 89.33
Stem 0
Stem Tuber 0
Unclassified 2.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0001972 3300049568 Bacteria 12962
2 JGI25153J46596_10022723 3300003215 Bacteria 2303
3 Ga0070666_10177394 3300005335 Bacteria 1494
4 Ga0070689_100753432 3300005340 Bacteria 854
5 Ga0070711_100295817 3300005439 Bacteria 1286
6 Ga0070663_100574003 3300005455 Bacteria 945
7 Ga0070678_100269388 3300005456 Bacteria 1436
8 Ga0070681_10017866 3300005458 Bacteria 7087
9 Ga0070686_100169699 3300005544 Bacteria 1542
10 Ga0070665_100094993 3300005548 Bacteria 2986
11 Ga0068856_100025196 3300005614 Bacteria 5796
12 Ga0068852_100031097 3300005616 Bacteria 4401
13 Ga0068861_100174682 3300005719 Unclassified 1783
14 Ga0075367_10137159 3300006178 Bacteria 1514
15 Ga0075433_10014600 3300006852 Bacteria 6421
16 Ga0075434_100653836 3300006871 Bacteria 1069
17 Ga0075435_100661287 3300007076 Bacteria 907
18 Ga0105239_10428048 3300010375 Bacteria 1500
19 Ga0157380_10005202 3300014326 Bacteria 9094
20 Ga0157376_10169616 3300014969 Bacteria 1986
21 Ga0209758_1000257 3300025297 Bacteria 106321
22 Ga0207663_10118044 3300025916 Bacteria 1811
23 Ga0207694_10731603 3300025924 Bacteria 835
24 Ga0207670_10567574 3300025936 Bacteria 929
25 Ga0207702_10107797 3300026078 Bacteria 2471
26 Ga0207675_100005533 3300026118 Bacteria 12080
27 Ga0207675_100419537 3300026118 Unclassified 1321
28 Ga0207675_100574672 3300026118 Bacteria 1128
29 Ga0207683_10060096 3300026121 Bacteria 3340
30 Ga0207698_10047307 3300026142 Bacteria 3257
31 Ga0268266_10108242 3300028379 Bacteria 2459
32 Ga0265340_10019514 3300031247 Bacteria 3491
33 Ga0307408_100344623 3300031548 Bacteria 1262
34 Ga0307413_10045099 3300031824 Bacteria 2611
35 Ga0307410_10039271 3300031852 Bacteria 3106
36 Ga0307407_10026824 3300031903 Bacteria 3056
37 Ga0307412_10359525 3300031911 Bacteria 1172
38 Ga0307412_10520384 3300031911 Bacteria 994
39 Ga0307409_100023776 3300031995 Bacteria 4256
40 Ga0307411_10115679 3300032005 Bacteria 1929
41 Ga0395900_0119128 3300037418 Bacteria 2710
42 Ga0436365_1348547 3300039437 Bacteria 3599
43 Ga0436362_0768479 3300039453 Bacteria 1005
44 Ga0451791_0640581 3300041451 Bacteria 3812
45 Ga0451807_0365833 3300041486 Bacteria 3057
46 Ga0439460_0055757 3300042461 Bacteria 1195
47 Ga0451576_0017379 3300045051 Bacteria 7910
48 Ga0451576_0093389 3300045051 Bacteria 3129
49 Ga0495629_0113043 3300046459 Bacteria 1893
50 Ga0495653_0037183 3300046463 Bacteria 3828
51 Ga0495586_0289130 3300046535 Unclassified 938
52 Ga0495686_0012736 3300047472 Bacteria 5870
53 Ga0495686_0360631 3300047472 Bacteria 788
54 Ga0496101_0019104 3300048904 Bacteria 4672
55 Ga0496102_0153350 3300048905 Bacteria 2166
56 Ga0496109_0432772 3300048912 Bacteria 1243
57 Ga0496110_0056120 3300048913 Bacteria 3466
58 Ga0496121_0000572 3300048924 Bacteria 69364
59 Ga0501031_0004928 3300049568 Bacteria 8676
60 Ga0501032_0011768 3300049569 Bacteria 6271
61 Ga0501032_0012199 3300049569 Bacteria 6151
62 Ga0501032_0020881 3300049569 Bacteria 4556
63 Ga0501033_0000174 3300049570 Bacteria 61376
64 Ga0501033_0002073 3300049570 Bacteria 17410
65 Ga0501033_0113178 3300049570 Bacteria 1973
66 Ga0501034_0002653 3300049571 Bacteria 21171
67 Ga0501034_0008554 3300049571 Bacteria 10802
68 Ga0501034_0013250 3300049571 Bacteria 8494
69 Ga0501034_0053222 3300049571 Bacteria 4077
70 Ga0501034_0161582 3300049571 Bacteria 2210
71 Ga0501036_0001536 3300049572 Bacteria 17831
72 Ga0501036_0006494 3300049572 Bacteria 9500
73 Ga0501036_0009825 3300049572 Bacteria 7878
74 Ga0501036_0039217 3300049572 Bacteria 4009
75 Ga0501036_0645525 3300049572 Bacteria 876
76 Ga0501037_0005604 3300049573 Bacteria 9150
77 Ga0501037_0006625 3300049573 Bacteria 8469
78 Ga0501037_0028592 3300049573 Bacteria 4117
79 Ga0501038_0000992 3300049574 Bacteria 25526
80 Ga0501038_0011067 3300049574 Bacteria 8239
81 Ga0501038_0066051 3300049574 Bacteria 3081
82 Ga0501038_0231352 3300049574 Bacteria 1471
83 Ga0501038_0249884 3300049574 Bacteria 1405
84 Ga0501039_0008850 3300049575 Bacteria 7670
85 Ga0501039_0014484 3300049575 Bacteria 6038
86 Ga0501042_0012368 3300049578 Bacteria 5779
87 Ga0501043_0000736 3300049579 Bacteria 29004
88 Ga0501043_0012490 3300049579 Bacteria 6645
89 Ga0501043_0026154 3300049579 Bacteria 4579
90 Ga0501043_0066819 3300049579 Bacteria 2823
91 Ga0501046_0002621 3300049580 Bacteria 16801
92 Ga0501046_0118592 3300049580 Bacteria 2015
93 Ga0501046_0162881 3300049580 Bacteria 1677
94 Ga0501047_0000124 3300049581 Bacteria 94721
95 Ga0501047_0111550 3300049581 Bacteria 2617
96 Ga0501047_0261523 3300049581 Bacteria 1578
97 Ga0501048_0000566 3300049582 Bacteria 26246
98 Ga0501048_0011162 3300049582 Bacteria 6698
99 Ga0501048_0121810 3300049582 Bacteria 1843
100 Ga0501067_0005169 3300049583 Bacteria 7255
101 Ga0501067_0253951 3300049583 Unclassified 979
102 Ga0501068_0003779 3300049584 Bacteria 8203
103 Ga0501068_0017717 3300049584 Bacteria 4121
104 Ga0501069_0015774 3300049585 Bacteria 4049
105 Ga0501070_0001240 3300049586 Bacteria 22856
106 Ga0501070_0006254 3300049586 Bacteria 10133
107 Ga0501070_0025591 3300049586 Bacteria 4949
108 Ga0501071_0016836 3300049587 Bacteria 5029
109 Ga0501071_0049840 3300049587 Bacteria 3015
110 Ga0501073_0015911 3300049589 Bacteria 5451
111 Ga0501073_0300819 3300049589 Bacteria 1107
112 Ga0501074_0002164 3300049590 Bacteria 13618
113 Ga0501074_0018340 3300049590 Bacteria 5082
114 Ga0501074_0116415 3300049590 Bacteria 1912
115 Ga0501074_0381585 3300049590 Bacteria 1000
116 Ga0501076_0108425 3300049592 Bacteria 2243
117 Ga0501079_0020104 3300049741 Bacteria 5102
118 Ga0501079_0026991 3300049741 Bacteria 4402
119 Ga0501080_0000130 3300049742 Bacteria 53465
120 Ga0501080_0297319 3300049742 Bacteria 1465
121 Ga0501081_0383811 3300049743 Bacteria 1038
122 Ga0501083_0000480 3300049744 Bacteria 25565
123 Ga0501035_0014689 3300049822 Bacteria 7228
124 Ga0501035_0065147 3300049822 Bacteria 3236
125 Ga0501035_0150560 3300049822 Bacteria 2019
126 Ga0501044_0013795 3300049823 Bacteria 8732
127 Ga0501044_0014077 3300049823 Bacteria 8637
128 Ga0501044_0128787 3300049823 Bacteria 2526
129 Ga0501044_0176602 3300049823 Bacteria 2104
130 Ga0501044_0695710 3300049823 Bacteria 902
131 Ga0501045_0010354 3300049824 Bacteria 6531
132 Ga0501045_0074072 3300049824 Bacteria 2507
133 nmdc:mga00v17_25650_c1 3300050491 Bacteria 3428
134 nmdc:mga0n895_545342_c1 3300050512 Bacteria 1166
135 nmdc:mga0a205_21348_c1 3300050515 Bacteria 6126
136 Ga0495601_0075264 3300053077 Bacteria 2161
137 Ga0500595_014576 3300053119 Bacteria 2979
138 Ga0500616_0018656 3300053153 Bacteria 3920
139 Ga0501084_0000140 3300054114 Bacteria 54374
140 Ga0501084_0013224 3300054114 Bacteria 6830
141 Ga0501082_0016102 3300060353 Bacteria 6432
142 Ga0501082_0049670 3300060353 Bacteria 3618
143 Ga0501082_0058429 3300060353 Bacteria 3323
144 Ga0501082_1021220 3300060353 Bacteria 723
145 2643950684 2643221588 Bacteria 3692460
146 2848298901 2848297114 Bacteria 3608511
147 8021623280 8021622325 Bacteria 4844743
148 8021627715 8021626552 Bacteria 4665214
149 8021651274 8021648035 Bacteria 4772378
150 8056879546 8056875544 Bacteria 4355797
151 Ga0501031_0001972
152 JGI25153J46596_10022723
153 Ga0070666_10177394
154 Ga0070689_100753432
155 Ga0070711_100295817
156 Ga0070663_100574003
157 Ga0070678_100269388
158 Ga0070681_10017866
159 Ga0070686_100169699
160 Ga0070665_100094993
161 Ga0068856_100025196
162 Ga0068852_100031097
163 Ga0068861_100174682
164 Ga0075367_10137159
165 Ga0075433_10014600
166 Ga0075434_100653836
167 Ga0075435_100661287
168 Ga0105239_10428048
169 Ga0157380_10005202
170 Ga0157376_10169616
171 Ga0209758_1000257
172 Ga0207663_10118044
173 Ga0207694_10731603
174 Ga0207670_10567574
175 Ga0207702_10107797
176 Ga0207675_100005533
177 Ga0207675_100419537
178 Ga0207675_100574672
179 Ga0207683_10060096
180 Ga0207698_10047307
181 Ga0268266_10108242
182 Ga0265340_10019514
183 Ga0307408_100344623
184 Ga0307413_10045099
185 Ga0307410_10039271
186 Ga0307407_10026824
187 Ga0307412_10359525
188 Ga0307412_10520384
189 Ga0307409_100023776
190 Ga0307411_10115679
191 Ga0395900_0119128
192 Ga0436365_1348547
193 Ga0436362_0768479
194 Ga0451791_0640581
195 Ga0451807_0365833
196 Ga0439460_0055757
197 Ga0451576_0017379
198 Ga0451576_0093389
199 Ga0495629_0113043
200 Ga0495653_0037183
201 Ga0495586_0289130
202 Ga0495686_0012736
203 Ga0495686_0360631
204 Ga0496101_0019104
205 Ga0496102_0153350
206 Ga0496109_0432772
207 Ga0496110_0056120
208 Ga0496121_0000572
209 Ga0501031_0004928
210 Ga0501032_0011768
211 Ga0501032_0012199
212 Ga0501032_0020881
213 Ga0501033_0000174
214 Ga0501033_0002073
215 Ga0501033_0113178
216 Ga0501034_0002653
217 Ga0501034_0008554
218 Ga0501034_0013250
219 Ga0501034_0053222
220 Ga0501034_0161582
221 Ga0501036_0001536
222 Ga0501036_0006494
223 Ga0501036_0009825
224 Ga0501036_0039217
225 Ga0501036_0645525
226 Ga0501037_0005604
227 Ga0501037_0006625
228 Ga0501037_0028592
229 Ga0501038_0000992
230 Ga0501038_0011067
231 Ga0501038_0066051
232 Ga0501038_0231352
233 Ga0501038_0249884
234 Ga0501039_0008850
235 Ga0501039_0014484
236 Ga0501042_0012368
237 Ga0501043_0000736
238 Ga0501043_0012490
239 Ga0501043_0026154
240 Ga0501043_0066819
241 Ga0501046_0002621
242 Ga0501046_0118592
243 Ga0501046_0162881
244 Ga0501047_0000124
245 Ga0501047_0111550
246 Ga0501047_0261523
247 Ga0501048_0000566
248 Ga0501048_0011162
249 Ga0501048_0121810
250 Ga0501067_0005169
251 Ga0501067_0253951
252 Ga0501068_0003779
253 Ga0501068_0017717
254 Ga0501069_0015774
255 Ga0501070_0001240
256 Ga0501070_0006254
257 Ga0501070_0025591
258 Ga0501071_0016836
259 Ga0501071_0049840
260 Ga0501073_0015911
261 Ga0501073_0300819
262 Ga0501074_0002164
263 Ga0501074_0018340
264 Ga0501074_0116415
265 Ga0501074_0381585
266 Ga0501076_0108425
267 Ga0501079_0020104
268 Ga0501079_0026991
269 Ga0501080_0000130
270 Ga0501080_0297319
271 Ga0501081_0383811
272 Ga0501083_0000480
273 Ga0501035_0014689
274 Ga0501035_0065147
275 Ga0501035_0150560
276 Ga0501044_0013795
277 Ga0501044_0014077
278 Ga0501044_0128787
279 Ga0501044_0176602
280 Ga0501044_0695710
281 Ga0501045_0010354
282 Ga0501045_0074072
283 nmdc:mga00v17_25650_c1
284 nmdc:mga0n895_545342_c1
285 nmdc:mga0a205_21348_c1
286 Ga0495601_0075264
287 Ga0500595_014576
288 Ga0500616_0018656
289 Ga0501084_0000140
290 Ga0501084_0013224
291 Ga0501082_0016102
292 Ga0501082_0049670
293 Ga0501082_0058429
294 Ga0501082_1021220
295 2643950684
296 2848298901
297 8021623280
298 8021627715
299 8021651274
300 8056879546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

30

255

0.94

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

35

247

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.9821 37 263
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.9653 37 263
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.9383 35 263
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.9294 37 265
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.9268 35 263
ID Description Score Start End Superfamily
af_P37329_30_103_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9948 39 102 3.40.190.10
6nioA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9728 115 226 3.40.190.10
6nioA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9643 115 226 3.40.190.10
af_P9WGU3_42_110_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9559 39 105 3.40.190.10
6nioA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9463 35 263 3.40.190.10
ID Description Score Start End GO Terms
AF-G2GXH0-F1-model_v4 Molybdenum ABC transporter, periplasmic molybdate-binding protein 0.9761 40 266 GO:0015689
GO:0030288
GO:0030973
GO:0046872
AF-G2GXH0-F1-model_v4 Molybdenum ABC transporter, periplasmic molybdate-binding protein 0.9594 40 266 GO:0015689
GO:0030288
GO:0030973
GO:0046872
AF-I5BYI5-F1-model_v4 Molybdenum ABC transporter periplasmic molybdenum-binding protein 0.9422 46 266 GO:0015689
GO:0030288
GO:0030973
GO:0046872
AF-A0A5M4AET4-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9351 50 269 GO:0015689
GO:0030288
GO:0030973
GO:0046872
AF-I5BYI5-F1-model_v4 Molybdenum ABC transporter periplasmic molybdenum-binding protein 0.9337 46 266 GO:0015689
GO:0030288
GO:0030973
GO:0046872

Map