F209808

General Info

Members Datasets Scaffolds Average Seq Length
150 103 300 265

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0039941|Ga0496117_0039941_1917_2753
Length 278
Sequence MFERKEGMTILVTGATGLVGERLVPRLVEAGEDCRILVRPGKTAPAGVQAVEGDLFDPASLANAVTGVSAIVHLAAVFRTQDNDLIWKSNLEGTRSLIAAVKTNAPAARLVMASTSNVYNKNSPRPGRETDAVEPAEAYPASKIAAEEALRESGLNWAVVRFPFVYGDGDGHLEMLPKHLDAFGFHPANRMSTIHHRDIATAMKLALAGTFDRRIVNIADEAPTTIYELVKLVGENMSPSSEPMPNPWHLHVDGSLARSLGFQPTVRTVYQAEQEGLL

Samples

Sample ID Description Type Environment
1 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
29 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
31 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
32 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
33 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
38 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
58 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
59 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
60 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
61 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
62 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
63 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
64 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
65 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
66 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
67 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
68 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
69 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
70 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
71 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
72 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
73 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
74 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
75 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
77 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
78 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
79 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
80 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
81 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
82 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
83 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
84 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
85 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
86 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
87 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
88 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
89 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
90 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
91 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
92 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
93 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
94 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
95 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
96 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
97 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
98 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
99 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
100 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
101 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
102 2919404418 Luteibacter sp. 3190 Isolate Unclassified
103 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.33
Metatranscriptomes 0
Isolates 12.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.67
Nodule 3.33
Rhizoplane 5.33
Rhizosphere 36
Stem 0
Stem Tuber 0
Unclassified 6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496117_0039941 3300048920 Bacteria 3457
2 SwRhRL2b_contig_2381925 2162886007 Bacteria 45817
3 JGI25152J39213_1001376 3300002773 Bacteria 10576
4 JGI25152J39213_1016234 3300002773 Bacteria 1443
5 JGI25150J39212_1000423 3300002774 Bacteria 19455
6 JGI25153J46596_10000785 3300003215 Bacteria 19455
7 rootH2_10057517 3300003320 Bacteria 2556
8 Ga0055524_1003832 3300003775 Bacteria 7139
9 Ga0055536_1000156 3300003781 Bacteria 59021
10 Ga0055528_1000926 3300003790 Bacteria 19597
11 Ga0055530_10007197 3300003791 Bacteria 4750
12 Ga0055540_1000794 3300003792 Bacteria 21378
13 Ga0055531_10000121 3300003794 Bacteria 87524
14 Ga0055531_10001083 3300003794 Bacteria 21388
15 Ga0065165_1000001 3300005262 Bacteria 494087
16 Ga0065165_1000526 3300005262 Bacteria 58564
17 Ga0065165_1001468 3300005262 Bacteria 25249
18 Ga0065704_10070189 3300005289 Bacteria 114786
19 Ga0065704_10082726 3300005289 Bacteria 3559
20 Ga0070668_100071812 3300005347 Bacteria 2696
21 Ga0070671_100058841 3300005355 Bacteria 3198
22 Ga0070667_100007128 3300005367 Bacteria 9292
23 Ga0070665_100000686 3300005548 Bacteria 45211
24 Ga0070665_100084934 3300005548 Bacteria 3170
25 Ga0070665_100112636 3300005548 Bacteria 2724
26 Ga0068863_100000980 3300005841 Bacteria 28685
27 Ga0068860_100001156 3300005843 Bacteria 28867
28 Ga0068862_100107961 3300005844 Bacteria 2441
29 Ga0075365_10073543 3300006038 Bacteria 2304
30 Ga0105251_10002713 3300009011 Bacteria 13579
31 Ga0105247_10087880 3300009101 Bacteria 1969
32 Ga0114129_10220685 3300009147 Unclassified 2557
33 Ga0105248_10026552 3300009177 Bacteria 6442
34 Ga0163162_10495055 3300013306 Bacteria 1353
35 Ga0163161_10130526 3300017792 Bacteria 1895
36 Ga0163161_10146270 3300017792 Bacteria 1793
37 Ga0209674_100403 3300025226 Bacteria 21586
38 Ga0207427_104447 3300025231 Bacteria 2359
39 Ga0207425_1000358 3300025245 Bacteria 31539
40 Ga0209129_1003244 3300025258 Bacteria 7230
41 Ga0209129_1005802 3300025258 Bacteria 4216
42 Ga0209673_1001669 3300025273 Bacteria 19004
43 Ga0209676_1000031 3300025292 Bacteria 478976
44 Ga0209676_1000077 3300025292 Bacteria 298831
45 Ga0209025_1000202 3300025294 Bacteria 145750
46 Ga0209564_1001358 3300025295 Bacteria 25759
47 Ga0209758_1000763 3300025297 Bacteria 46387
48 Ga0209050_1000135 3300025298 Bacteria 184020
49 Ga0209050_1002213 3300025298 Bacteria 17453
50 Ga0209050_1024786 3300025298 Bacteria 2062
51 Ga0209256_1001348 3300025299 Bacteria 26052
52 Ga0209051_1001339 3300025303 Bacteria 21403
53 Ga0209257_1000050 3300025304 Bacteria 439325
54 Ga0209257_1002033 3300025304 Bacteria 21569
55 Ga0209257_1040806 3300025304 Bacteria 1382
56 Ga0207713_1029399 3300025735 Unclassified 2462
57 Ga0207681_10010254 3300025923 Bacteria 5737
58 Ga0207650_10016472 3300025925 Bacteria 5167
59 Ga0207711_10002655 3300025941 Bacteria 15808
60 Ga0207711_10252698 3300025941 Bacteria 1619
61 Ga0207668_10195552 3300025972 Bacteria 1606
62 Ga0207658_10003596 3300025986 Bacteria 10953
63 Ga0207641_10000469 3300026088 Bacteria 45572
64 Ga0268266_10000804 3300028379 Bacteria 41628
65 Ga0268266_10120029 3300028379 Bacteria 2339
66 Ga0268266_10294412 3300028379 Bacteria 1512
67 Ga0268264_10036101 3300028381 Bacteria 4069
68 Ga0314311_1050202 3300030733 Unclassified 1703
69 Ga0307405_10001621 3300031731 Bacteria 9573
70 Ga0307405_10132414 3300031731 Bacteria 1725
71 Ga0307413_10005521 3300031824 Bacteria 5656
72 Ga0307410_10062664 3300031852 Bacteria 2549
73 Ga0307414_10000294 3300032004 Bacteria 29187
74 Ga0395905_0008095 3300037471 Bacteria 10383
75 Ga0436361_0244142 3300039447 Bacteria 2423
76 Ga0466968_0010796 3300044735 Bacteria 3548
77 Ga0466957_0000863 3300044842 Bacteria 15558
78 Ga0466957_0087416 3300044842 Bacteria 1949
79 Ga0495627_015371 3300046453 Bacteria 2643
80 Ga0495607_0000019 3300046501 Bacteria 167319
81 Ga0495606_0002356 3300046507 Bacteria 22178
82 Ga0495643_0000035 3300046522 Bacteria 238464
83 Ga0495643_0005795 3300046522 Bacteria 8269
84 Ga0495633_0002579 3300046558 Bacteria 12684
85 Ga0496106_0132969 3300048909 Unclassified 1952
86 Ga0496116_0031796 3300048919 Bacteria 3770
87 Ga0496116_0038254 3300048919 Bacteria 3335
88 Ga0496116_0191719 3300048919 Bacteria 1081
89 Ga0496117_0007548 3300048920 Bacteria 10595
90 Ga0496117_0193700 3300048920 Bacteria 1155
91 Ga0496118_0000343 3300048921 Bacteria 78995
92 Ga0496118_0044535 3300048921 Bacteria 3474
93 Ga0496118_0045147 3300048921 Bacteria 3443
94 Ga0496118_0062691 3300048921 Bacteria 2741
95 Ga0496118_0113505 3300048921 Bacteria 1790
96 Ga0496120_0036837 3300048923 Bacteria 2907
97 Ga0496120_0089761 3300048923 Bacteria 1644
98 Ga0496121_0067735 3300048924 Bacteria 2892
99 Ga0496121_0101185 3300048924 Unclassified 2223
100 Ga0496121_0144844 3300048924 Bacteria 1757
101 Ga0496122_0008964 3300048925 Bacteria 10639
102 Ga0496122_0073401 3300048925 Bacteria 2426
103 Ga0496123_0004205 3300048926 Bacteria 15365
104 Ga0496123_0020635 3300048926 Bacteria 5148
105 Ga0496123_0131727 3300048926 Bacteria 1383
106 Ga0496123_0134661 3300048926 Bacteria 1362
107 Ga0496124_0000220 3300048927 Bacteria 111209
108 Ga0496124_0001047 3300048927 Bacteria 43685
109 Ga0496124_0019718 3300048927 Bacteria 6264
110 Ga0496124_0164581 3300048927 Bacteria 1725
111 Ga0496124_0176338 3300048927 Bacteria 1649
112 Ga0496124_0367714 3300048927 Bacteria 1011
113 Ga0496125_0003030 3300048928 Bacteria 21015
114 Ga0496125_0024850 3300048928 Bacteria 5498
115 Ga0496125_0100693 3300048928 Bacteria 2129
116 Ga0496125_0122861 3300048928 Bacteria 1847
117 Ga0496125_0283027 3300048928 Bacteria 1026
118 Ga0496126_0000243 3300048929 Bacteria 117685
119 Ga0496126_0009054 3300048929 Bacteria 10643
120 Ga0496126_0029975 3300048929 Bacteria 5163
121 Ga0496126_0486592 3300048929 Unclassified 988
122 Ga0501034_0270321 3300049571 Unclassified 1641
123 Ga0501080_0400720 3300049742 Unclassified 1234
124 Ga0501241_000780 3300049758 Bacteria 6740
125 nmdc:mga0yw44_19099_c1 3300050492 Bacteria 3772
126 nmdc:mga05p37_223581_c1 3300050507 Unclassified 2271
127 nmdc:mga0sz30_63278_c1 3300050516 Bacteria 1583
128 Ga0500641_0032129 3300053096 Bacteria 2074
129 Ga0500633_0000554 3300053160 Bacteria 6066
130 Ga0500634_0000010 3300053161 Bacteria 138411
131 Ga0500645_036780 3300053730 Bacteria 1456
132 2509390389 2509276021 Bacteria 7634384
133 2523105536 2522572158 Bacteria 6514390
134 2554249301 2554235003 Bacteria 5877155
135 2585993528 2585427633 Bacteria 6413184
136 2599100558 2597490356 Bacteria 7030811
137 2599611407 2599185212 Bacteria 6765997
138 2600022393 2599185316 Bacteria 6320029
139 2600027415 2599185317 Bacteria 6435722
140 2600057355 2599185322 Bacteria 6763055
141 2600075668 2599185325 Bacteria 6324919
142 2600356876 2600254930 Bacteria 6431253
143 2671124454 2667528176 Bacteria 6724917
144 2841866284 2841864319 Bacteria 6742987
145 2842342168 2842341865 Bacteria 7003929
146 2842365856 2842363717 Bacteria 6844742
147 2848297756 2848297114 Bacteria 3608511
148 2884965341 2884960567 Bacteria 5437054
149 2919405566 2919404418 Bacteria 4232372
150 8054007905 8054002106 Bacteria 7987183
151 Ga0496117_0039941
152 SwRhRL2b_contig_2381925
153 JGI25152J39213_1001376
154 JGI25152J39213_1016234
155 JGI25150J39212_1000423
156 JGI25153J46596_10000785
157 rootH2_10057517
158 Ga0055524_1003832
159 Ga0055536_1000156
160 Ga0055528_1000926
161 Ga0055530_10007197
162 Ga0055540_1000794
163 Ga0055531_10000121
164 Ga0055531_10001083
165 Ga0065165_1000001
166 Ga0065165_1000526
167 Ga0065165_1001468
168 Ga0065704_10070189
169 Ga0065704_10082726
170 Ga0070668_100071812
171 Ga0070671_100058841
172 Ga0070667_100007128
173 Ga0070665_100000686
174 Ga0070665_100084934
175 Ga0070665_100112636
176 Ga0068863_100000980
177 Ga0068860_100001156
178 Ga0068862_100107961
179 Ga0075365_10073543
180 Ga0105251_10002713
181 Ga0105247_10087880
182 Ga0114129_10220685
183 Ga0105248_10026552
184 Ga0163162_10495055
185 Ga0163161_10130526
186 Ga0163161_10146270
187 Ga0209674_100403
188 Ga0207427_104447
189 Ga0207425_1000358
190 Ga0209129_1003244
191 Ga0209129_1005802
192 Ga0209673_1001669
193 Ga0209676_1000031
194 Ga0209676_1000077
195 Ga0209025_1000202
196 Ga0209564_1001358
197 Ga0209758_1000763
198 Ga0209050_1000135
199 Ga0209050_1002213
200 Ga0209050_1024786
201 Ga0209256_1001348
202 Ga0209051_1001339
203 Ga0209257_1000050
204 Ga0209257_1002033
205 Ga0209257_1040806
206 Ga0207713_1029399
207 Ga0207681_10010254
208 Ga0207650_10016472
209 Ga0207711_10002655
210 Ga0207711_10252698
211 Ga0207668_10195552
212 Ga0207658_10003596
213 Ga0207641_10000469
214 Ga0268266_10000804
215 Ga0268266_10120029
216 Ga0268266_10294412
217 Ga0268264_10036101
218 Ga0314311_1050202
219 Ga0307405_10001621
220 Ga0307405_10132414
221 Ga0307413_10005521
222 Ga0307410_10062664
223 Ga0307414_10000294
224 Ga0395905_0008095
225 Ga0436361_0244142
226 Ga0466968_0010796
227 Ga0466957_0000863
228 Ga0466957_0087416
229 Ga0495627_015371
230 Ga0495607_0000019
231 Ga0495606_0002356
232 Ga0495643_0000035
233 Ga0495643_0005795
234 Ga0495633_0002579
235 Ga0496106_0132969
236 Ga0496116_0031796
237 Ga0496116_0038254
238 Ga0496116_0191719
239 Ga0496117_0007548
240 Ga0496117_0193700
241 Ga0496118_0000343
242 Ga0496118_0044535
243 Ga0496118_0045147
244 Ga0496118_0062691
245 Ga0496118_0113505
246 Ga0496120_0036837
247 Ga0496120_0089761
248 Ga0496121_0067735
249 Ga0496121_0101185
250 Ga0496121_0144844
251 Ga0496122_0008964
252 Ga0496122_0073401
253 Ga0496123_0004205
254 Ga0496123_0020635
255 Ga0496123_0131727
256 Ga0496123_0134661
257 Ga0496124_0000220
258 Ga0496124_0001047
259 Ga0496124_0019718
260 Ga0496124_0164581
261 Ga0496124_0176338
262 Ga0496124_0367714
263 Ga0496125_0003030
264 Ga0496125_0024850
265 Ga0496125_0100693
266 Ga0496125_0122861
267 Ga0496125_0283027
268 Ga0496126_0000243
269 Ga0496126_0009054
270 Ga0496126_0029975
271 Ga0496126_0486592
272 Ga0501034_0270321
273 Ga0501080_0400720
274 Ga0501241_000780
275 nmdc:mga0yw44_19099_c1
276 nmdc:mga05p37_223581_c1
277 nmdc:mga0sz30_63278_c1
278 Ga0500641_0032129
279 Ga0500633_0000554
280 Ga0500634_0000010
281 Ga0500645_036780
282 2509390389
283 2523105536
284 2554249301
285 2585993528
286 2599100558
287 2599611407
288 2600022393
289 2600027415
290 2600057355
291 2600075668
292 2600356876
293 2671124454
294 2841866284
295 2842342168
296 2842365856
297 2848297756
298 2884965341
299 2919405566
300 8054007905

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

8

180

0.9

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

11

156

0.9

PF05368

NmrA

NmrA-like family

10

175

0.85

PF07993

NAD_binding_4

Male sterility protein

43

205

0.84

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

11

196

0.81

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

10

219

0.81

PF13460

NAD_binding_10

NAD(P)H-binding

14

208

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k3p-assembly1.cif.gz_B the structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni 0.8418 2 262
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8345 1 258
1lrk-assembly1.cif.gz_A crystal structure of escherichia coli udp-galactose 4-epimerase mutant y299c complexed with udp-n-acetylglucosamine 0.8293 1 267
4wok-assembly1.cif.gz_A crystal structure of udp-glucose 4-epimerase from brucella ovis in complex with nad 0.8285 2 271
4wok-assembly1.cif.gz_A crystal structure of udp-glucose 4-epimerase from brucella ovis in complex with nad 0.8229 2 271
ID Description Score Start End Superfamily
af_A0A1D6GVM8_196_300_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9064 1 97 3.40.50.20
af_I1KVW6_141_273_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.902 1 98 3.40.50.20
af_I1KG15_128_276_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8788 1 100 3.40.50.720
af_I1LJN4_7_360_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8751 2 225 3.40.50.720
af_A0A1D6MTK5_41_178_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.869 2 109 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2T5U769-F1-model_v4 RmlD substrate binding domain-containing protein 0.9922 121 271 GO:0004029
GO:0005737
AF-F3ZB88-F1-model_v4 Putative NAD-dependent epimerase/dehydratase 0.9919 1 271 GO:0004029
GO:0005737
AF-F3ZB88-F1-model_v4 Putative NAD-dependent epimerase/dehydratase 0.9883 1 271 GO:0004029
GO:0005737
AF-H0E036-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) 0.9882 2 271 GO:0003978
GO:0004029
GO:0005737
AF-A0A839VRS0-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9858 45 271 GO:0004029
GO:0005737

Map