F209735

General Info

Members Datasets Scaffolds Average Seq Length
150 111 300 147

Family's Representative Sequence

Representative Sequence 3300046809|Ga0495600_0637979|Ga0495600_0637979_96_593
Length 165
Sequence MAAIIRAMATRCIYTVRRRAGIRMSDNQEFGKVEGADGILTIRGGDNVRGWNGIRYKSGLSAKNVGAKKLSMNVATIPPGGVAYAHIHVDFEVMLYILAGRVRHEYGPALEQTLENQAGDFIFIEPGVPHEVFNMSQTEPVVAVVARSDASEWENIVNFTRPDKR

Samples

Sample ID Description Type Environment
1 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
86 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
102 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
103 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
104 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
105 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
106 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
110 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
111 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 3.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 0
Rhizosphere 96
Stem 0
Stem Tuber 0
Unclassified 28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495600_0637979 3300046809 Unclassified 645
2 Ga0065707_10538542 3300005295 Unclassified 729
3 Ga0070658_10506095 3300005327 Unclassified 1043
4 Ga0070690_100069072 3300005330 Bacteria 2292
5 Ga0070690_100102487 3300005330 Bacteria 1899
6 Ga0068869_100995409 3300005334 Unclassified 730
7 Ga0070680_100345880 3300005336 Bacteria 1264
8 Ga0070689_100096586 3300005340 Bacteria 2336
9 Ga0070661_100772583 3300005344 Unclassified 787
10 Ga0070661_101021443 3300005344 Bacteria 686
11 Ga0070671_100069696 3300005355 Bacteria 2933
12 Ga0070673_100129220 3300005364 Bacteria 2117
13 Ga0070688_100047303 3300005365 Bacteria 2668
14 Ga0070688_100228781 3300005365 Unclassified 1314
15 Ga0070667_100092709 3300005367 Bacteria 2600
16 Ga0070709_10119388 3300005434 Bacteria 1785
17 Ga0070701_10024596 3300005438 Bacteria 2914
18 Ga0070701_11148434 3300005438 Bacteria 549
19 Ga0070705_100160772 3300005440 Bacteria 1501
20 Ga0070705_100404092 3300005440 Bacteria 1012
21 Ga0070694_100084721 3300005444 Bacteria 2212
22 Ga0070708_100607441 3300005445 Bacteria 1031
23 Ga0070708_101419004 3300005445 Unclassified 647
24 Ga0070663_100766333 3300005455 Unclassified 825
25 Ga0070663_100873135 3300005455 Unclassified 775
26 Ga0070662_100328830 3300005457 Unclassified 1248
27 Ga0070662_100345603 3300005457 Bacteria 1218
28 Ga0070681_10130322 3300005458 Archaea 2447
29 Ga0070706_100004800 3300005467 Bacteria 12955
30 Ga0070706_100053878 3300005467 Bacteria 3713
31 Ga0070707_100027990 3300005468 Bacteria 5362
32 Ga0070707_100037205 3300005468 Bacteria 4644
33 Ga0070707_100159275 3300005468 Bacteria 2199
34 Ga0070698_100002509 3300005471 Bacteria 20233
35 Ga0070698_100032052 3300005471 Bacteria 5446
36 Ga0070698_100184725 3300005471 Bacteria 2023
37 Ga0070699_100112144 3300005518 Bacteria 2395
38 Ga0070699_101537542 3300005518 Bacteria 610
39 Ga0070684_100644117 3300005535 Bacteria 986
40 Ga0070697_100146941 3300005536 Bacteria 1985
41 Ga0070697_100206612 3300005536 Bacteria 1671
42 Ga0070672_100065816 3300005543 Bacteria 2867
43 Ga0070686_100291606 3300005544 Unclassified 1207
44 Ga0070704_100000855 3300005549 Bacteria 15211
45 Ga0070704_100126523 3300005549 Bacteria 1973
46 Ga0070704_100275876 3300005549 Bacteria 1391
47 Ga0068857_100515552 3300005577 Bacteria 1123
48 Ga0068854_100351660 3300005578 Bacteria 1206
49 Ga0068852_100468579 3300005616 Bacteria 1250
50 Ga0068859_100032400 3300005617 Bacteria 5251
51 Ga0068859_100283035 3300005617 Bacteria 1751
52 Ga0068859_101879949 3300005617 Unclassified 661
53 Ga0068861_100307448 3300005719 Bacteria 1376
54 Ga0068861_100403094 3300005719 Unclassified 1214
55 Ga0068863_100173448 3300005841 Bacteria 2069
56 Ga0068860_100864784 3300005843 Bacteria 919
57 Ga0068862_100022502 3300005844 Bacteria 5272
58 Ga0068862_102215362 3300005844 Bacteria 561
59 Ga0070717_11185427 3300006028 Bacteria 695
60 Ga0070712_100257154 3300006175 Unclassified 1398
61 Ga0097621_100946011 3300006237 Unclassified 804
62 Ga0068871_100713931 3300006358 Unclassified 919
63 Ga0075428_100005496 3300006844 Bacteria 14092
64 Ga0075433_10022348 3300006852 Bacteria 5309
65 Ga0068865_100054902 3300006881 Bacteria 2771
66 Ga0075436_100000067 3300006914 Bacteria 62714
67 Ga0097620_100032400 3300006931 Bacteria 5251
68 Ga0097620_100283071 3300006931 Bacteria 1751
69 Ga0097620_101880051 3300006931 Unclassified 661
70 Ga0111539_10049356 3300009094 Bacteria 5020
71 Ga0111539_10070028 3300009094 Bacteria 4141
72 Ga0111539_11095159 3300009094 Bacteria 926
73 Ga0105242_10163941 3300009176 Unclassified 1948
74 Ga0105248_10530333 3300009177 Bacteria 1328
75 Ga0105248_10639096 3300009177 Bacteria 1201
76 Ga0105248_10883188 3300009177 Unclassified 1009
77 Ga0105249_10042897 3300009553 Bacteria 4115
78 Ga0099796_10122036 3300010159 Unclassified 1002
79 Ga0157373_10190161 3300013100 Unclassified 1446
80 Ga0157378_10672288 3300013297 Bacteria 1053
81 Ga0157378_11475445 3300013297 Bacteria 724
82 Ga0157378_11532741 3300013297 Unclassified 711
83 Ga0157372_10274838 3300013307 Bacteria 1958
84 Ga0157375_10840797 3300013308 Unclassified 1065
85 Ga0184603_128649 3300019192 Unclassified 944
86 Ga0224712_10023746 3300022467 Unclassified 2132
87 Ga0224712_10044568 3300022467 Bacteria 1692
88 Ga0207680_10078609 3300025903 Bacteria 2066
89 Ga0207699_10066845 3300025906 Bacteria 2184
90 Ga0207684_10016777 3300025910 Bacteria 6289
91 Ga0207707_10622698 3300025912 Unclassified 912
92 Ga0207693_10361527 3300025915 Unclassified 1136
93 Ga0207693_10694420 3300025915 Bacteria 788
94 Ga0207660_10280956 3300025917 Bacteria 1321
95 Ga0207662_10160011 3300025918 Bacteria 1438
96 Ga0207662_10392363 3300025918 Bacteria 939
97 Ga0207646_10004995 3300025922 Bacteria 14149
98 Ga0207646_10014847 3300025922 Bacteria 7379
99 Ga0207659_10671934 3300025926 Unclassified 886
100 Ga0207706_10466999 3300025933 Unclassified 1091
101 Ga0207704_10262952 3300025938 Bacteria 1302
102 Ga0207691_10031358 3300025940 Bacteria 4961
103 Ga0207711_10519529 3300025941 Unclassified 1110
104 Ga0207651_10011178 3300025960 Bacteria 5012
105 Ga0207712_10347989 3300025961 Bacteria 1231
106 Ga0207678_10871980 3300026067 Unclassified 796
107 Ga0207675_100134082 3300026118 Bacteria 2349
108 Ga0207675_100381557 3300026118 Bacteria 1386
109 Ga0207675_100587765 3300026118 Unclassified 1115
110 Ga0268265_11710223 3300028380 Unclassified 635
111 Ga0268264_11299927 3300028381 Bacteria 737
112 Ga0265762_1154415 3300030760 Unclassified 549
113 Ga0265760_10070691 3300031090 Unclassified 1070
114 Ga0307405_10150536 3300031731 Bacteria 1635
115 Ga0307405_11733435 3300031731 Unclassified 554
116 Ga0307410_10008118 3300031852 Bacteria 5798
117 Ga0307412_10700851 3300031911 Bacteria 869
118 Ga0307415_101548142 3300032126 Bacteria 635
119 Ga0436365_0729525 3300039437 Bacteria 705
120 Ga0436363_0519865 3300039450 Bacteria 785
121 Ga0436363_0950468 3300039450 Unclassified 589
122 Ga0451853_1504043 3300041512 Bacteria 1039
123 Ga0439434_0182845 3300042435 Unclassified 702
124 Ga0451577_0432727 3300042876 Bacteria 1195
125 Ga0453684_0552953 3300044712 Bacteria 1268
126 Ga0466957_0912681 3300044842 Bacteria 628
127 Ga0451576_0029633 3300045051 Bacteria 5855
128 Ga0466967_1897423 3300045976 Bacteria 593
129 Ga0495638_0212950 3300046460 Bacteria 1084
130 Ga0495653_0026811 3300046463 Bacteria 4617
131 Ga0495664_0259490 3300046477 Bacteria 1051
132 Ga0495643_0000008 3300046522 Bacteria 367010
133 Ga0495645_0332746 3300046543 Bacteria 983
134 Ga0495658_0117018 3300046683 Bacteria 1608
135 Ga0495684_0398263 3300047471 Bacteria 967
136 Ga0501040_0773032 3300049576 Unclassified 695
137 Ga0501068_0306461 3300049584 Bacteria 1017
138 Ga0501233_230398 3300049668 Bacteria 550
139 Ga0501249_000625 3300049679 Bacteria 8159
140 Ga0501249_007353 3300049679 Bacteria 2274
141 Ga0501245_001816 3300049708 Bacteria 2807
142 Ga0501263_001012 3300049760 Bacteria 2481
143 Ga0501279_053907 3300049775 Unclassified 644
144 Ga0501045_0965012 3300049824 Bacteria 625
145 nmdc:mga08y16_266332_c1 3300050511 Bacteria 1769
146 nmdc:mga08y16_814183_c1 3300050511 Bacteria 926
147 nmdc:mga0rr50_573124_c1 3300050513 Bacteria 962
148 Ga0500554_117164 3300053102 Unclassified 897
149 Ga0500628_000173 3300053129 Bacteria 12469
150 Ga0501082_1037505 3300060353 Unclassified 717
151 Ga0495600_0637979
152 Ga0065707_10538542
153 Ga0070658_10506095
154 Ga0070690_100069072
155 Ga0070690_100102487
156 Ga0068869_100995409
157 Ga0070680_100345880
158 Ga0070689_100096586
159 Ga0070661_100772583
160 Ga0070661_101021443
161 Ga0070671_100069696
162 Ga0070673_100129220
163 Ga0070688_100047303
164 Ga0070688_100228781
165 Ga0070667_100092709
166 Ga0070709_10119388
167 Ga0070701_10024596
168 Ga0070701_11148434
169 Ga0070705_100160772
170 Ga0070705_100404092
171 Ga0070694_100084721
172 Ga0070708_100607441
173 Ga0070708_101419004
174 Ga0070663_100766333
175 Ga0070663_100873135
176 Ga0070662_100328830
177 Ga0070662_100345603
178 Ga0070681_10130322
179 Ga0070706_100004800
180 Ga0070706_100053878
181 Ga0070707_100027990
182 Ga0070707_100037205
183 Ga0070707_100159275
184 Ga0070698_100002509
185 Ga0070698_100032052
186 Ga0070698_100184725
187 Ga0070699_100112144
188 Ga0070699_101537542
189 Ga0070684_100644117
190 Ga0070697_100146941
191 Ga0070697_100206612
192 Ga0070672_100065816
193 Ga0070686_100291606
194 Ga0070704_100000855
195 Ga0070704_100126523
196 Ga0070704_100275876
197 Ga0068857_100515552
198 Ga0068854_100351660
199 Ga0068852_100468579
200 Ga0068859_100032400
201 Ga0068859_100283035
202 Ga0068859_101879949
203 Ga0068861_100307448
204 Ga0068861_100403094
205 Ga0068863_100173448
206 Ga0068860_100864784
207 Ga0068862_100022502
208 Ga0068862_102215362
209 Ga0070717_11185427
210 Ga0070712_100257154
211 Ga0097621_100946011
212 Ga0068871_100713931
213 Ga0075428_100005496
214 Ga0075433_10022348
215 Ga0068865_100054902
216 Ga0075436_100000067
217 Ga0097620_100032400
218 Ga0097620_100283071
219 Ga0097620_101880051
220 Ga0111539_10049356
221 Ga0111539_10070028
222 Ga0111539_11095159
223 Ga0105242_10163941
224 Ga0105248_10530333
225 Ga0105248_10639096
226 Ga0105248_10883188
227 Ga0105249_10042897
228 Ga0099796_10122036
229 Ga0157373_10190161
230 Ga0157378_10672288
231 Ga0157378_11475445
232 Ga0157378_11532741
233 Ga0157372_10274838
234 Ga0157375_10840797
235 Ga0184603_128649
236 Ga0224712_10023746
237 Ga0224712_10044568
238 Ga0207680_10078609
239 Ga0207699_10066845
240 Ga0207684_10016777
241 Ga0207707_10622698
242 Ga0207693_10361527
243 Ga0207693_10694420
244 Ga0207660_10280956
245 Ga0207662_10160011
246 Ga0207662_10392363
247 Ga0207646_10004995
248 Ga0207646_10014847
249 Ga0207659_10671934
250 Ga0207706_10466999
251 Ga0207704_10262952
252 Ga0207691_10031358
253 Ga0207711_10519529
254 Ga0207651_10011178
255 Ga0207712_10347989
256 Ga0207678_10871980
257 Ga0207675_100134082
258 Ga0207675_100381557
259 Ga0207675_100587765
260 Ga0268265_11710223
261 Ga0268264_11299927
262 Ga0265762_1154415
263 Ga0265760_10070691
264 Ga0307405_10150536
265 Ga0307405_11733435
266 Ga0307410_10008118
267 Ga0307412_10700851
268 Ga0307415_101548142
269 Ga0436365_0729525
270 Ga0436363_0519865
271 Ga0436363_0950468
272 Ga0451853_1504043
273 Ga0439434_0182845
274 Ga0451577_0432727
275 Ga0453684_0552953
276 Ga0466957_0912681
277 Ga0451576_0029633
278 Ga0466967_1897423
279 Ga0495638_0212950
280 Ga0495653_0026811
281 Ga0495664_0259490
282 Ga0495643_0000008
283 Ga0495645_0332746
284 Ga0495658_0117018
285 Ga0495684_0398263
286 Ga0501040_0773032
287 Ga0501068_0306461
288 Ga0501233_230398
289 Ga0501249_000625
290 Ga0501249_007353
291 Ga0501245_001816
292 Ga0501263_001012
293 Ga0501279_053907
294 Ga0501045_0965012
295 nmdc:mga08y16_266332_c1
296 nmdc:mga08y16_814183_c1
297 nmdc:mga0rr50_573124_c1
298 Ga0500554_117164
299 Ga0500628_000173
300 Ga0501082_1037505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

73

147

0.94

PF00190

Cupin_1

Cupin

58

161

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.9441 50 130
5wsf-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.9232 34 128
3ww1-assembly1.cif.gz_A x-ray structure of cellulomonas parahominis l-ribose isomerase with l-ribose 0.9156 50 133
7zvy-assembly4.cif.gz_H thermococcus kadokarensis phosphomannose isomerase 0.9132 34 131
5wse-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.9123 34 128
ID Description Score Start End Superfamily
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.927 34 129 2.60.120.10
af_O06336_46_171_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9177 35 141 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9167 35 130 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9166 48 141 2.60.120.10
3ww1A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9156 50 133 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A538NES1-F1-model_v4 Cupin domain-containing protein 1.002 53 142
AF-A0A2V6I1H0-F1-model_v4 Cupin 0.9989 40 142
AF-A0A2V8CYI2-F1-model_v4 Cupin 0.9948 9 141
AF-A0A1B1TCK2-F1-model_v4 Cupin type-2 domain-containing protein 0.9934 31 144
AF-A0A2V5RVD9-F1-model_v4 Cupin 0.9932 61 142

Map