F209157
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 150 | 27 | 300 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300031344|Ga0265316_10006521|Ga0265316_100065219 |
| Length | 178 |
| Sequence | MIESLIIAGSGGQGVMLLGKVLAEVIMRQGRQVSWFPAYGPEVRGGTSHCMVTISDQEIGSPYVTKADTLIILNNPSLERFKSRVKDKGLLVLNSSLAKISGFGRIKVLQFPFTDLAIGLGNIKVANMVALGCYLGAKKIVKTEEVLKVFKAMAPAGKADILEINQRALQEGVKLGNG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 2 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 3 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 4 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 5 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 6 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 7 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 8 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 9 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 10 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 11 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 12 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 13 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 16 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 17 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 18 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 19 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 20 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 21 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 22 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 23 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 24 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 25 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 26 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 27 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98 |
| Metatranscriptomes | 2 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.67 |
| Rhizosphere | 93.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265316_10006521 | 3300031344 | Bacteria | 11131 |
| 2 | Ga0265337_1043616 | 3300028556 | Unclassified | 1282 |
| 3 | Ga0265323_10000914 | 3300028653 | Bacteria | 15572 |
| 4 | Ga0265322_10030511 | 3300028654 | Bacteria | 1540 |
| 5 | Ga0265338_10002534 | 3300028800 | Bacteria | 27082 |
| 6 | Ga0265338_10006958 | 3300028800 | Bacteria | 14219 |
| 7 | Ga0265338_10798152 | 3300028800 | Bacteria | 647 |
| 8 | Ga0265327_10001213 | 3300031251 | Bacteria | 34774 |
| 9 | Ga0265327_10007464 | 3300031251 | Bacteria | 8434 |
| 10 | Ga0265327_10010863 | 3300031251 | Bacteria | 6344 |
| 11 | Ga0265316_10005637 | 3300031344 | Bacteria | 12117 |
| 12 | Ga0265316_10026422 | 3300031344 | Bacteria | 4828 |
| 13 | Ga0265316_10240643 | 3300031344 | Bacteria | 1331 |
| 14 | Ga0265342_10085856 | 3300031712 | Bacteria | 1810 |
| 15 | Ga0265342_10213143 | 3300031712 | Bacteria | 1043 |
| 16 | Ga0316576_10034306 | 3300031727 | Bacteria | 3616 |
| 17 | Ga0316576_10050134 | 3300031727 | Bacteria | 3035 |
| 18 | Ga0316576_10145264 | 3300031727 | Bacteria | 1786 |
| 19 | Ga0316576_10155212 | 3300031727 | Bacteria | 1725 |
| 20 | Ga0316576_10538182 | 3300031727 | Bacteria | 857 |
| 21 | Ga0316578_10049021 | 3300031728 | Bacteria | 2468 |
| 22 | Ga0316578_10136308 | 3300031728 | Bacteria | 1478 |
| 23 | Ga0316578_10217354 | 3300031728 | Unclassified | 1149 |
| 24 | Ga0316578_10302440 | 3300031728 | Bacteria | 956 |
| 25 | Ga0316577_10039080 | 3300031733 | Bacteria | 2655 |
| 26 | Ga0316577_10055181 | 3300031733 | Bacteria | 2217 |
| 27 | Ga0316583_10133831 | 3300032133 | Bacteria | 864 |
| 28 | Ga0316585_10004255 | 3300032137 | Bacteria | 3976 |
| 29 | Ga0316585_10025305 | 3300032137 | Bacteria | 1840 |
| 30 | Ga0316592_1096520 | 3300033524 | Bacteria | 678 |
| 31 | Ga0316588_1072855 | 3300033528 | Bacteria | 845 |
| 32 | Ga0316588_1126227 | 3300033528 | Bacteria | 649 |
| 33 | Ga0316574_0012001 | 3300035398 | Bacteria | 4943 |
| 34 | Ga0316574_0057360 | 3300035398 | Unclassified | 2438 |
| 35 | Ga0316574_0208530 | 3300035398 | Bacteria | 1254 |
| 36 | Ga0316574_0315847 | 3300035398 | Bacteria | 992 |
| 37 | Ga0316582_0004771 | 3300036647 | Bacteria | 6909 |
| 38 | Ga0316582_0011378 | 3300036647 | Bacteria | 4915 |
| 39 | Ga0316582_0101055 | 3300036647 | Unclassified | 1910 |
| 40 | Ga0316582_0135958 | 3300036647 | Bacteria | 1654 |
| 41 | Ga0316584_0000530 | 3300036712 | Bacteria | 20366 |
| 42 | Ga0316584_0008059 | 3300036712 | Bacteria | 7235 |
| 43 | Ga0316584_0088442 | 3300036712 | Bacteria | 2319 |
| 44 | Ga0316584_0171164 | 3300036712 | Bacteria | 1611 |
| 45 | Ga0316584_0196700 | 3300036712 | Bacteria | 1489 |
| 46 | Ga0316584_0297014 | 3300036712 | Bacteria | 1170 |
| 47 | Ga0400488_53586 | 3300038741 | Bacteria | 1684 |
| 48 | Ga0400483_018673 | 3300039062 | Bacteria | 1744 |
| 49 | Ga0400483_040985 | 3300039062 | Bacteria | 8036 |
| 50 | Ga0400483_151455 | 3300039062 | Bacteria | 2601 |
| 51 | Ga0400483_207934 | 3300039062 | Bacteria | 4797 |
| 52 | Ga0400483_252857 | 3300039062 | Unclassified | 1207 |
| 53 | Ga0400489_19543 | 3300039093 | Bacteria | 4920 |
| 54 | Ga0451795_0293406 | 3300041456 | Bacteria | 928 |
| 55 | Ga0451837_0854348 | 3300041494 | Bacteria | 1138 |
| 56 | Ga0451855_1254493 | 3300041511 | Bacteria | 4544 |
| 57 | Ga0451577_0000027 | 3300042876 | Bacteria | 397014 |
| 58 | Ga0451577_0002094 | 3300042876 | Bacteria | 24552 |
| 59 | Ga0451577_0005982 | 3300042876 | Bacteria | 12252 |
| 60 | Ga0451577_0055120 | 3300042876 | Bacteria | 3548 |
| 61 | Ga0451577_0075136 | 3300042876 | Bacteria | 3013 |
| 62 | Ga0451577_0127179 | 3300042876 | Bacteria | 2284 |
| 63 | Ga0451577_0237584 | 3300042876 | Bacteria | 1649 |
| 64 | Ga0451577_0283020 | 3300042876 | Bacteria | 1502 |
| 65 | Ga0451577_0336329 | 3300042876 | Bacteria | 1369 |
| 66 | Ga0451577_0566181 | 3300042876 | Bacteria | 1031 |
| 67 | Ga0451577_0790377 | 3300042876 | Unclassified | 857 |
| 68 | Ga0453683_0000010 | 3300044673 | Bacteria | 470890 |
| 69 | Ga0453683_0000084 | 3300044673 | Bacteria | 142500 |
| 70 | Ga0453683_0000289 | 3300044673 | Bacteria | 65192 |
| 71 | Ga0453683_0001057 | 3300044673 | Bacteria | 25583 |
| 72 | Ga0453683_0021005 | 3300044673 | Bacteria | 4169 |
| 73 | Ga0453683_0027773 | 3300044673 | Bacteria | 3586 |
| 74 | Ga0453683_0045460 | 3300044673 | Bacteria | 2753 |
| 75 | Ga0453683_0058228 | 3300044673 | Bacteria | 2417 |
| 76 | Ga0453683_0086982 | 3300044673 | Bacteria | 1958 |
| 77 | Ga0453683_0106350 | 3300044673 | Bacteria | 1763 |
| 78 | Ga0453683_0202808 | 3300044673 | Bacteria | 1259 |
| 79 | Ga0453683_0238690 | 3300044673 | Bacteria | 1157 |
| 80 | Ga0453683_0267832 | 3300044673 | Bacteria | 1090 |
| 81 | Ga0453683_0269082 | 3300044673 | Bacteria | 1087 |
| 82 | Ga0453683_0317713 | 3300044673 | Bacteria | 998 |
| 83 | Ga0453683_0391647 | 3300044673 | Bacteria | 895 |
| 84 | Ga0453683_0571699 | 3300044673 | Bacteria | 736 |
| 85 | Ga0453684_0000154 | 3300044712 | Bacteria | 305062 |
| 86 | Ga0453684_0000202 | 3300044712 | Bacteria | 261894 |
| 87 | Ga0453684_0000452 | 3300044712 | Bacteria | 165844 |
| 88 | Ga0453684_0000529 | 3300044712 | Bacteria | 145936 |
| 89 | Ga0453684_0000547 | 3300044712 | Bacteria | 142253 |
| 90 | Ga0453684_0001629 | 3300044712 | Bacteria | 61225 |
| 91 | Ga0453684_0001826 | 3300044712 | Bacteria | 55887 |
| 92 | Ga0453684_0003233 | 3300044712 | Bacteria | 37275 |
| 93 | Ga0453684_0004060 | 3300044712 | Bacteria | 31814 |
| 94 | Ga0453684_0006648 | 3300044712 | Bacteria | 21842 |
| 95 | Ga0453684_0007559 | 3300044712 | Bacteria | 19927 |
| 96 | Ga0453684_0010605 | 3300044712 | Bacteria | 15717 |
| 97 | Ga0453684_0011129 | 3300044712 | Bacteria | 15175 |
| 98 | Ga0453684_0017311 | 3300044712 | Bacteria | 11177 |
| 99 | Ga0453684_0019966 | 3300044712 | Bacteria | 10157 |
| 100 | Ga0453684_0023344 | 3300044712 | Bacteria | 9119 |
| 101 | Ga0453684_0024847 | 3300044712 | Bacteria | 8727 |
| 102 | Ga0453684_0028940 | 3300044712 | Bacteria | 7886 |
| 103 | Ga0453684_0036022 | 3300044712 | Bacteria | 6826 |
| 104 | Ga0453684_0047310 | 3300044712 | Bacteria | 5706 |
| 105 | Ga0453684_0049876 | 3300044712 | Bacteria | 5511 |
| 106 | Ga0453684_0054770 | 3300044712 | Bacteria | 5192 |
| 107 | Ga0453684_0061932 | 3300044712 | Bacteria | 4798 |
| 108 | Ga0453684_0085394 | 3300044712 | Bacteria | 3921 |
| 109 | Ga0453684_0089525 | 3300044712 | Bacteria | 3806 |
| 110 | Ga0453684_0097643 | 3300044712 | Bacteria | 3605 |
| 111 | Ga0453684_0105991 | 3300044712 | Bacteria | 3427 |
| 112 | Ga0453684_0118777 | 3300044712 | Bacteria | 3197 |
| 113 | Ga0453684_0144198 | 3300044712 | Bacteria | 2839 |
| 114 | Ga0453684_0216254 | 3300044712 | Bacteria | 2223 |
| 115 | Ga0453684_0267641 | 3300044712 | Unclassified | 1955 |
| 116 | Ga0453684_0268203 | 3300044712 | Bacteria | 1952 |
| 117 | Ga0453684_0336717 | 3300044712 | Bacteria | 1705 |
| 118 | Ga0453684_0346499 | 3300044712 | Bacteria | 1676 |
| 119 | Ga0453684_0423559 | 3300044712 | Bacteria | 1486 |
| 120 | Ga0453684_0604650 | 3300044712 | Bacteria | 1201 |
| 121 | Ga0453684_0663056 | 3300044712 | Bacteria | 1137 |
| 122 | Ga0453684_0670937 | 3300044712 | Bacteria | 1129 |
| 123 | Ga0453684_0738777 | 3300044712 | Bacteria | 1066 |
| 124 | Ga0453684_0799865 | 3300044712 | Bacteria | 1017 |
| 125 | Ga0453684_0888552 | 3300044712 | Unclassified | 955 |
| 126 | Ga0453684_0912147 | 3300044712 | Bacteria | 940 |
| 127 | Ga0453684_1025163 | 3300044712 | Bacteria | 876 |
| 128 | Ga0451576_0000032 | 3300045051 | Bacteria | 397014 |
| 129 | Ga0451576_0000112 | 3300045051 | Bacteria | 209574 |
| 130 | Ga0451576_0000275 | 3300045051 | Bacteria | 126175 |
| 131 | Ga0451576_0001281 | 3300045051 | Bacteria | 43771 |
| 132 | Ga0451576_0003584 | 3300045051 | Bacteria | 21115 |
| 133 | Ga0451576_0005470 | 3300045051 | Bacteria | 15909 |
| 134 | Ga0451576_0019562 | 3300045051 | Bacteria | 7389 |
| 135 | Ga0451576_0024223 | 3300045051 | Bacteria | 6558 |
| 136 | Ga0451576_0025414 | 3300045051 | Bacteria | 6379 |
| 137 | Ga0451576_0035731 | 3300045051 | Bacteria | 5270 |
| 138 | Ga0451576_0037981 | 3300045051 | Bacteria | 5098 |
| 139 | Ga0451576_0054236 | 3300045051 | Bacteria | 4198 |
| 140 | Ga0451576_0065623 | 3300045051 | Bacteria | 3779 |
| 141 | Ga0451576_0072756 | 3300045051 | Bacteria | 3577 |
| 142 | Ga0451576_0113359 | 3300045051 | Bacteria | 2822 |
| 143 | Ga0451576_0126730 | 3300045051 | Bacteria | 2660 |
| 144 | Ga0451576_0128463 | 3300045051 | Bacteria | 2641 |
| 145 | Ga0451576_0166035 | 3300045051 | Bacteria | 2304 |
| 146 | Ga0451576_0291542 | 3300045051 | Bacteria | 1706 |
| 147 | Ga0451576_0298104 | 3300045051 | Bacteria | 1686 |
| 148 | Ga0451576_0305865 | 3300045051 | Bacteria | 1663 |
| 149 | Ga0451576_1169370 | 3300045051 | Bacteria | 804 |
| 150 | Ga0451576_1576069 | 3300045051 | Bacteria | 681 |
| 151 | Ga0265316_10006521 | |||
| 152 | Ga0265337_1043616 | |||
| 153 | Ga0265323_10000914 | |||
| 154 | Ga0265322_10030511 | |||
| 155 | Ga0265338_10002534 | |||
| 156 | Ga0265338_10006958 | |||
| 157 | Ga0265338_10798152 | |||
| 158 | Ga0265327_10001213 | |||
| 159 | Ga0265327_10007464 | |||
| 160 | Ga0265327_10010863 | |||
| 161 | Ga0265316_10005637 | |||
| 162 | Ga0265316_10026422 | |||
| 163 | Ga0265316_10240643 | |||
| 164 | Ga0265342_10085856 | |||
| 165 | Ga0265342_10213143 | |||
| 166 | Ga0316576_10034306 | |||
| 167 | Ga0316576_10050134 | |||
| 168 | Ga0316576_10145264 | |||
| 169 | Ga0316576_10155212 | |||
| 170 | Ga0316576_10538182 | |||
| 171 | Ga0316578_10049021 | |||
| 172 | Ga0316578_10136308 | |||
| 173 | Ga0316578_10217354 | |||
| 174 | Ga0316578_10302440 | |||
| 175 | Ga0316577_10039080 | |||
| 176 | Ga0316577_10055181 | |||
| 177 | Ga0316583_10133831 | |||
| 178 | Ga0316585_10004255 | |||
| 179 | Ga0316585_10025305 | |||
| 180 | Ga0316592_1096520 | |||
| 181 | Ga0316588_1072855 | |||
| 182 | Ga0316588_1126227 | |||
| 183 | Ga0316574_0012001 | |||
| 184 | Ga0316574_0057360 | |||
| 185 | Ga0316574_0208530 | |||
| 186 | Ga0316574_0315847 | |||
| 187 | Ga0316582_0004771 | |||
| 188 | Ga0316582_0011378 | |||
| 189 | Ga0316582_0101055 | |||
| 190 | Ga0316582_0135958 | |||
| 191 | Ga0316584_0000530 | |||
| 192 | Ga0316584_0008059 | |||
| 193 | Ga0316584_0088442 | |||
| 194 | Ga0316584_0171164 | |||
| 195 | Ga0316584_0196700 | |||
| 196 | Ga0316584_0297014 | |||
| 197 | Ga0400488_53586 | |||
| 198 | Ga0400483_018673 | |||
| 199 | Ga0400483_040985 | |||
| 200 | Ga0400483_151455 | |||
| 201 | Ga0400483_207934 | |||
| 202 | Ga0400483_252857 | |||
| 203 | Ga0400489_19543 | |||
| 204 | Ga0451795_0293406 | |||
| 205 | Ga0451837_0854348 | |||
| 206 | Ga0451855_1254493 | |||
| 207 | Ga0451577_0000027 | |||
| 208 | Ga0451577_0002094 | |||
| 209 | Ga0451577_0005982 | |||
| 210 | Ga0451577_0055120 | |||
| 211 | Ga0451577_0075136 | |||
| 212 | Ga0451577_0127179 | |||
| 213 | Ga0451577_0237584 | |||
| 214 | Ga0451577_0283020 | |||
| 215 | Ga0451577_0336329 | |||
| 216 | Ga0451577_0566181 | |||
| 217 | Ga0451577_0790377 | |||
| 218 | Ga0453683_0000010 | |||
| 219 | Ga0453683_0000084 | |||
| 220 | Ga0453683_0000289 | |||
| 221 | Ga0453683_0001057 | |||
| 222 | Ga0453683_0021005 | |||
| 223 | Ga0453683_0027773 | |||
| 224 | Ga0453683_0045460 | |||
| 225 | Ga0453683_0058228 | |||
| 226 | Ga0453683_0086982 | |||
| 227 | Ga0453683_0106350 | |||
| 228 | Ga0453683_0202808 | |||
| 229 | Ga0453683_0238690 | |||
| 230 | Ga0453683_0267832 | |||
| 231 | Ga0453683_0269082 | |||
| 232 | Ga0453683_0317713 | |||
| 233 | Ga0453683_0391647 | |||
| 234 | Ga0453683_0571699 | |||
| 235 | Ga0453684_0000154 | |||
| 236 | Ga0453684_0000202 | |||
| 237 | Ga0453684_0000452 | |||
| 238 | Ga0453684_0000529 | |||
| 239 | Ga0453684_0000547 | |||
| 240 | Ga0453684_0001629 | |||
| 241 | Ga0453684_0001826 | |||
| 242 | Ga0453684_0003233 | |||
| 243 | Ga0453684_0004060 | |||
| 244 | Ga0453684_0006648 | |||
| 245 | Ga0453684_0007559 | |||
| 246 | Ga0453684_0010605 | |||
| 247 | Ga0453684_0011129 | |||
| 248 | Ga0453684_0017311 | |||
| 249 | Ga0453684_0019966 | |||
| 250 | Ga0453684_0023344 | |||
| 251 | Ga0453684_0024847 | |||
| 252 | Ga0453684_0028940 | |||
| 253 | Ga0453684_0036022 | |||
| 254 | Ga0453684_0047310 | |||
| 255 | Ga0453684_0049876 | |||
| 256 | Ga0453684_0054770 | |||
| 257 | Ga0453684_0061932 | |||
| 258 | Ga0453684_0085394 | |||
| 259 | Ga0453684_0089525 | |||
| 260 | Ga0453684_0097643 | |||
| 261 | Ga0453684_0105991 | |||
| 262 | Ga0453684_0118777 | |||
| 263 | Ga0453684_0144198 | |||
| 264 | Ga0453684_0216254 | |||
| 265 | Ga0453684_0267641 | |||
| 266 | Ga0453684_0268203 | |||
| 267 | Ga0453684_0336717 | |||
| 268 | Ga0453684_0346499 | |||
| 269 | Ga0453684_0423559 | |||
| 270 | Ga0453684_0604650 | |||
| 271 | Ga0453684_0663056 | |||
| 272 | Ga0453684_0670937 | |||
| 273 | Ga0453684_0738777 | |||
| 274 | Ga0453684_0799865 | |||
| 275 | Ga0453684_0888552 | |||
| 276 | Ga0453684_0912147 | |||
| 277 | Ga0453684_1025163 | |||
| 278 | Ga0451576_0000032 | |||
| 279 | Ga0451576_0000112 | |||
| 280 | Ga0451576_0000275 | |||
| 281 | Ga0451576_0001281 | |||
| 282 | Ga0451576_0003584 | |||
| 283 | Ga0451576_0005470 | |||
| 284 | Ga0451576_0019562 | |||
| 285 | Ga0451576_0024223 | |||
| 286 | Ga0451576_0025414 | |||
| 287 | Ga0451576_0035731 | |||
| 288 | Ga0451576_0037981 | |||
| 289 | Ga0451576_0054236 | |||
| 290 | Ga0451576_0065623 | |||
| 291 | Ga0451576_0072756 | |||
| 292 | Ga0451576_0113359 | |||
| 293 | Ga0451576_0126730 | |||
| 294 | Ga0451576_0128463 | |||
| 295 | Ga0451576_0166035 | |||
| 296 | Ga0451576_0291542 | |||
| 297 | Ga0451576_0298104 | |||
| 298 | Ga0451576_0305865 | |||
| 299 | Ga0451576_1169370 | |||
| 300 | Ga0451576_1576069 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3on3-assembly3.cif.gz_B | the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca | 0.899 | 1 | 176 |
| 3on3-assembly2.cif.gz_A | the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca | 0.8876 | 3 | 175 |
| 3on3-assembly3.cif.gz_B | the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca | 0.8606 | 1 | 176 |
| 3on3-assembly2.cif.gz_A | the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca | 0.8534 | 3 | 175 |
| 3g2e-assembly1.cif.gz_D | structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni | 0.8451 | 1 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZ05_1_182_3.40.920.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.89 | 2 | 176 | 3.40.920.10 |
| 3on3A00 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.88 | 3 | 170 | 3.40.920.10 |
| af_Q57717_1_177_3.40.920.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.8474 | 3 | 175 | 3.40.920.10 |
| af_Q2FZ05_1_182_3.40.920.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.845 | 2 | 176 | 3.40.920.10 |
| 3g2eC00 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.8295 | 1 | 180 | 3.40.920.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A831PQ56-F1-model_v4 | 2-oxoglutarate ferredoxin oxidoreductase subunit gamma | 0.9863 | 55 | 182 |
GO:0016903
|
| AF-A0A2J6ICK7-F1-model_v4 | 2-oxoglutarate ferredoxin oxidoreductase subunit gamma | 0.9837 | 1 | 178 |
GO:0016903
|
| AF-A0A180FIA4-F1-model_v4 | Pyruvate synthase subunit porC (EC 1.2.7.1) | 0.9835 | 1 | 180 |
GO:0019164
|
| AF-A0A1I5L2S5-F1-model_v4 | 2-oxoglutarate ferredoxin oxidoreductase subunit gamma | 0.9824 | 1 | 180 |
GO:0016903
|
| AF-A0A2M7E0B7-F1-model_v4 | 2-oxoglutarate ferredoxin oxidoreductase subunit gamma | 0.9792 | 71 | 180 |
GO:0016903
|