F208174
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 150 | 128 | 300 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300005459|Ga0068867_100330891|Ga0068867_1003308911 |
| Length | 298 |
| Sequence | MTLLTPLSNAMAARPAATMPGSPGSLAATDRPTEQRPAMSSSTPPPEMLDEVCRLARLAGQAVMAVYAQPITVRAKTDHSPVTQADEEAEALIIDGLSRLTPQIPIVAEEAVAAGRIPTLGERFWLVDPLDGTREFIDRNGEFTVNIALIEHGKPTLGVVFAPALSQTYSGVAGGPATLQDSRGEREIRCRAVPPEGLTVVASRSHGDEAALQSFLAGRRVAGLRHAGSSLKLCLIATGAADLYPRLGRTMEWDIAAGHAVLGAAGGRVCDLTGAELRYGKAGFANPHFVATGEAQRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 16 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 17 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 18 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 19 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 20 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 21 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 22 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 23 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 24 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 25 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 32 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 52 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 53 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 54 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 55 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 56 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 57 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 58 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 59 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 60 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 61 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 62 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 63 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 64 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 65 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 66 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 67 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 68 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 69 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 70 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 71 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 72 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 73 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 74 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 75 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 76 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 77 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 78 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 79 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 80 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 81 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 89 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 90 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 91 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 92 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 93 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 94 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 95 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 96 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 98 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 99 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 100 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 101 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 102 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 103 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 104 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 106 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 107 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 108 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 109 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 110 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 111 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 112 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 113 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 114 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 115 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 116 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 117 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 118 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 119 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 120 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 121 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 122 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 123 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 124 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 125 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 126 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 127 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 128 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.33 |
| Metatranscriptomes | 1.33 |
| Isolates | 5.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6 |
| Nodule | 0 |
| Rhizoplane | 2.67 |
| Rhizosphere | 77.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068867_100330891 | 3300005459 | Bacteria | 1265 |
| 2 | rootH1_10021069 | 3300003316 | Bacteria | 12095 |
| 3 | rootL2_10005287 | 3300003322 | Bacteria | 8193 |
| 4 | rootL2_10263564 | 3300003322 | Bacteria | 1886 |
| 5 | rootH1_10022879 | 3300003323 | Bacteria | 4681 |
| 6 | Ga0065715_10046455 | 3300005293 | Bacteria | 908 |
| 7 | Ga0065715_10093838 | 3300005293 | Bacteria | 4534 |
| 8 | Ga0065715_10255949 | 3300005293 | Bacteria | 1152 |
| 9 | Ga0070670_100228107 | 3300005331 | Bacteria | 1621 |
| 10 | Ga0070667_100655765 | 3300005367 | Bacteria | 969 |
| 11 | Ga0070714_100015367 | 3300005435 | Bacteria | 6161 |
| 12 | Ga0070714_100186944 | 3300005435 | Bacteria | 1888 |
| 13 | Ga0070711_100312106 | 3300005439 | Bacteria | 1254 |
| 14 | Ga0070708_100225407 | 3300005445 | Bacteria | 1758 |
| 15 | Ga0070706_100015427 | 3300005467 | Bacteria | 7057 |
| 16 | Ga0070706_100146356 | 3300005467 | Bacteria | 2206 |
| 17 | Ga0070707_100308672 | 3300005468 | Bacteria | 1537 |
| 18 | Ga0070699_100077100 | 3300005518 | Bacteria | 2901 |
| 19 | Ga0070697_100009300 | 3300005536 | Bacteria | 7681 |
| 20 | Ga0068855_100323422 | 3300005563 | Bacteria | 1704 |
| 21 | Ga0068852_100052150 | 3300005616 | Bacteria | 3515 |
| 22 | Ga0068852_100277265 | 3300005616 | Bacteria | 1615 |
| 23 | Ga0068852_100315329 | 3300005616 | Bacteria | 1517 |
| 24 | Ga0068864_100029918 | 3300005618 | Bacteria | 4616 |
| 25 | Ga0068858_100347999 | 3300005842 | Bacteria | 1419 |
| 26 | Ga0068862_100869357 | 3300005844 | Bacteria | 885 |
| 27 | Ga0075362_10146214 | 3300006177 | Bacteria | 1132 |
| 28 | Ga0075370_10104612 | 3300006353 | Bacteria | 1641 |
| 29 | Ga0075428_100038441 | 3300006844 | Bacteria | 5266 |
| 30 | Ga0075431_100092860 | 3300006847 | Bacteria | 3115 |
| 31 | Ga0075435_100010626 | 3300007076 | Bacteria | 6737 |
| 32 | Ga0105240_10130676 | 3300009093 | Bacteria | 3013 |
| 33 | Ga0114129_10256270 | 3300009147 | Bacteria | 2347 |
| 34 | Ga0114129_10581563 | 3300009147 | Bacteria | 1453 |
| 35 | Ga0105242_10583706 | 3300009176 | Bacteria | 1077 |
| 36 | Ga0105248_10013999 | 3300009177 | Bacteria | 8825 |
| 37 | Ga0105238_10402267 | 3300009551 | Bacteria | 1363 |
| 38 | Ga0105249_10002614 | 3300009553 | Bacteria | 15602 |
| 39 | Ga0105032_100071 | 3300009979 | Bacteria | 11396 |
| 40 | Ga0105239_10207268 | 3300010375 | Bacteria | 2197 |
| 41 | Ga0105239_11097144 | 3300010375 | Bacteria | 916 |
| 42 | Ga0157374_10041708 | 3300013296 | Bacteria | 4231 |
| 43 | Ga0163162_10589592 | 3300013306 | Bacteria | 1238 |
| 44 | Ga0157379_10010225 | 3300014968 | Bacteria | 8173 |
| 45 | Ga0207653_10030662 | 3300025885 | Bacteria | 1735 |
| 46 | Ga0207684_10063934 | 3300025910 | Bacteria | 3124 |
| 47 | Ga0207684_10208870 | 3300025910 | Bacteria | 1684 |
| 48 | Ga0207663_10127012 | 3300025916 | Bacteria | 1756 |
| 49 | Ga0207646_10104426 | 3300025922 | Bacteria | 2541 |
| 50 | Ga0207664_10017893 | 3300025929 | Bacteria | 5207 |
| 51 | Ga0207686_10430893 | 3300025934 | Bacteria | 1011 |
| 52 | Ga0207709_10171674 | 3300025935 | Bacteria | 1522 |
| 53 | Ga0207665_10322523 | 3300025939 | Bacteria | 1159 |
| 54 | Ga0207667_10362948 | 3300025949 | Bacteria | 1477 |
| 55 | Ga0207712_10008738 | 3300025961 | Bacteria | 6407 |
| 56 | Ga0207712_10313382 | 3300025961 | Bacteria | 1292 |
| 57 | Ga0207641_10134855 | 3300026088 | Bacteria | 2221 |
| 58 | Ga0207648_10329907 | 3300026089 | Bacteria | 1372 |
| 59 | Ga0207676_10059478 | 3300026095 | Bacteria | 3018 |
| 60 | Ga0207698_10021062 | 3300026142 | Bacteria | 4501 |
| 61 | Ga0207698_10144842 | 3300026142 | Bacteria | 2053 |
| 62 | Ga0268266_10560777 | 3300028379 | Bacteria | 1095 |
| 63 | Ga0265334_10000006 | 3300028573 | Bacteria | 235168 |
| 64 | Ga0307515_10016077 | 3300028794 | Bacteria | 13730 |
| 65 | Ga0265338_10131408 | 3300028800 | Bacteria | 1976 |
| 66 | Ga0307408_100000026 | 3300031548 | Bacteria | 261688 |
| 67 | Ga0265313_10001064 | 3300031595 | Bacteria | 26581 |
| 68 | Ga0307508_10177521 | 3300031616 | Bacteria | 1733 |
| 69 | Ga0316575_10007741 | 3300031665 | Bacteria | 3897 |
| 70 | Ga0316579_10002038 | 3300031691 | Bacteria | 7564 |
| 71 | Ga0316578_10101686 | 3300031728 | Bacteria | 1723 |
| 72 | Ga0307516_10000023 | 3300031730 | Bacteria | 190971 |
| 73 | Ga0307516_10000845 | 3300031730 | Bacteria | 42008 |
| 74 | Ga0307516_10147308 | 3300031730 | Bacteria | 2119 |
| 75 | Ga0307516_10178601 | 3300031730 | Bacteria | 1858 |
| 76 | Ga0316577_10152912 | 3300031733 | Bacteria | 1300 |
| 77 | Ga0316585_10000635 | 3300032137 | Bacteria | 8665 |
| 78 | Ga0316580_10021831 | 3300032139 | Bacteria | 1975 |
| 79 | Ga0316593_10001480 | 3300032168 | Bacteria | 5191 |
| 80 | Ga0316574_0000365 | 3300035398 | Bacteria | 17593 |
| 81 | Ga0316574_0012662 | 3300035398 | Bacteria | 4830 |
| 82 | Ga0316574_0143977 | 3300035398 | Bacteria | 1536 |
| 83 | Ga0373924_0004791 | 3300035410 | Bacteria | 4751 |
| 84 | Ga0316582_0001843 | 3300036647 | Bacteria | 9595 |
| 85 | Ga0316582_0326899 | 3300036647 | Bacteria | 1054 |
| 86 | Ga0395905_0002773 | 3300037471 | Bacteria | 19196 |
| 87 | Ga0395905_0164700 | 3300037471 | Bacteria | 2083 |
| 88 | Ga0400483_056155 | 3300039062 | Unclassified | 2095 |
| 89 | Ga0450917_000109 | 3300042120 | Bacteria | 5085 |
| 90 | Ga0450890_000664 | 3300042127 | Bacteria | 5016 |
| 91 | Ga0450891_001879 | 3300042129 | Bacteria | 2154 |
| 92 | Ga0450889_000266 | 3300042144 | Bacteria | 5808 |
| 93 | Ga0439458_0012265 | 3300042157 | Bacteria | 1922 |
| 94 | Ga0450893_0003953 | 3300042532 | Bacteria | 2351 |
| 95 | Ga0451577_0001405 | 3300042876 | Bacteria | 32181 |
| 96 | Ga0451577_0015533 | 3300042876 | Bacteria | 7081 |
| 97 | Ga0466972_0067906 | 3300044658 | Bacteria | 1703 |
| 98 | Ga0453684_0189179 | 3300044712 | Bacteria | 2409 |
| 99 | Ga0453684_0235295 | 3300044712 | Bacteria | 2112 |
| 100 | Ga0453684_0335961 | 3300044712 | Bacteria | 1707 |
| 101 | Ga0466960_0177322 | 3300044901 | Bacteria | 1153 |
| 102 | Ga0451576_0011622 | 3300045051 | Bacteria | 9975 |
| 103 | Ga0495603_0000824 | 3300046455 | Bacteria | 17836 |
| 104 | Ga0495594_0004010 | 3300046499 | Bacteria | 7576 |
| 105 | Ga0495598_0113854 | 3300046537 | Bacteria | 910 |
| 106 | Ga0495597_0031801 | 3300046542 | Bacteria | 2398 |
| 107 | Ga0495622_0000453 | 3300046557 | Bacteria | 26308 |
| 108 | Ga0495613_0134306 | 3300046689 | Bacteria | 1771 |
| 109 | Ga0495680_0111967 | 3300047322 | Bacteria | 2022 |
| 110 | Ga0496100_0291739 | 3300048903 | Bacteria | 1219 |
| 111 | Ga0496108_0111217 | 3300048911 | Bacteria | 2343 |
| 112 | Ga0496113_0228177 | 3300048916 | Bacteria | 1484 |
| 113 | Ga0496115_0150126 | 3300048918 | Bacteria | 1924 |
| 114 | Ga0496122_0060510 | 3300048925 | Bacteria | 2789 |
| 115 | Ga0496124_0034668 | 3300048927 | Bacteria | 4425 |
| 116 | Ga0496125_0040248 | 3300048928 | Bacteria | 4012 |
| 117 | Ga0496126_0035871 | 3300048929 | Bacteria | 4642 |
| 118 | Ga0495682_0015635 | 3300049460 | Bacteria | 2875 |
| 119 | Ga0501291_007656 | 3300049514 | Bacteria | 1471 |
| 120 | Ga0501314_000917 | 3300049530 | Bacteria | 1984 |
| 121 | Ga0501032_0041887 | 3300049569 | Bacteria | 3108 |
| 122 | Ga0501043_0000013 | 3300049579 | Bacteria | 185639 |
| 123 | Ga0501046_0000125 | 3300049580 | Bacteria | 81656 |
| 124 | Ga0501047_0000040 | 3300049581 | Bacteria | 185677 |
| 125 | Ga0501048_0002958 | 3300049582 | Bacteria | 12974 |
| 126 | Ga0501076_0059477 | 3300049592 | Bacteria | 3040 |
| 127 | Ga0501211_000812 | 3300049658 | Bacteria | 3235 |
| 128 | Ga0501222_002360 | 3300049662 | Bacteria | 2620 |
| 129 | Ga0501235_009427 | 3300049669 | Bacteria | 2133 |
| 130 | Ga0501255_002699 | 3300049684 | Bacteria | 1583 |
| 131 | Ga0501221_002791 | 3300049704 | Bacteria | 2874 |
| 132 | Ga0501272_001755 | 3300049769 | Bacteria | 2098 |
| 133 | Ga0501044_0057937 | 3300049823 | Bacteria | 3974 |
| 134 | Ga0501045_0015770 | 3300049824 | Bacteria | 5360 |
| 135 | nmdc:mga03683_34462_c1 | 3300050489 | Bacteria | 2048 |
| 136 | nmdc:mga07m45_48395_c1 | 3300050496 | Bacteria | 2391 |
| 137 | nmdc:mga06r32_137863_c1 | 3300050510 | Bacteria | 2414 |
| 138 | Ga0500607_164987 | 3300053121 | Bacteria | 1006 |
| 139 | Ga0500559_0050816 | 3300053136 | Bacteria | 1830 |
| 140 | Ga0500636_0043249 | 3300053177 | Bacteria | 2659 |
| 141 | Ga0500625_000897 | 3300053729 | Bacteria | 9271 |
| 142 | Ga0500645_027826 | 3300053730 | Bacteria | 1713 |
| 143 | 2512033169 | 2511231221 | Bacteria | 6846400 |
| 144 | 2523102462 | 2522572158 | Bacteria | 6514390 |
| 145 | 2599104879 | 2597490356 | Bacteria | 7030811 |
| 146 | 2846544637 | 2846540461 | Bacteria | 5471451 |
| 147 | 2846954400 | 2846952575 | Bacteria | 6587527 |
| 148 | 2848859340 | 2848858292 | Bacteria | 7391279 |
| 149 | 2897805477 | 2897803580 | Bacteria | 7000062 |
| 150 | 8054005073 | 8054002106 | Bacteria | 7987183 |
| 151 | Ga0068867_100330891 | |||
| 152 | rootH1_10021069 | |||
| 153 | rootL2_10005287 | |||
| 154 | rootL2_10263564 | |||
| 155 | rootH1_10022879 | |||
| 156 | Ga0065715_10046455 | |||
| 157 | Ga0065715_10093838 | |||
| 158 | Ga0065715_10255949 | |||
| 159 | Ga0070670_100228107 | |||
| 160 | Ga0070667_100655765 | |||
| 161 | Ga0070714_100015367 | |||
| 162 | Ga0070714_100186944 | |||
| 163 | Ga0070711_100312106 | |||
| 164 | Ga0070708_100225407 | |||
| 165 | Ga0070706_100015427 | |||
| 166 | Ga0070706_100146356 | |||
| 167 | Ga0070707_100308672 | |||
| 168 | Ga0070699_100077100 | |||
| 169 | Ga0070697_100009300 | |||
| 170 | Ga0068855_100323422 | |||
| 171 | Ga0068852_100052150 | |||
| 172 | Ga0068852_100277265 | |||
| 173 | Ga0068852_100315329 | |||
| 174 | Ga0068864_100029918 | |||
| 175 | Ga0068858_100347999 | |||
| 176 | Ga0068862_100869357 | |||
| 177 | Ga0075362_10146214 | |||
| 178 | Ga0075370_10104612 | |||
| 179 | Ga0075428_100038441 | |||
| 180 | Ga0075431_100092860 | |||
| 181 | Ga0075435_100010626 | |||
| 182 | Ga0105240_10130676 | |||
| 183 | Ga0114129_10256270 | |||
| 184 | Ga0114129_10581563 | |||
| 185 | Ga0105242_10583706 | |||
| 186 | Ga0105248_10013999 | |||
| 187 | Ga0105238_10402267 | |||
| 188 | Ga0105249_10002614 | |||
| 189 | Ga0105032_100071 | |||
| 190 | Ga0105239_10207268 | |||
| 191 | Ga0105239_11097144 | |||
| 192 | Ga0157374_10041708 | |||
| 193 | Ga0163162_10589592 | |||
| 194 | Ga0157379_10010225 | |||
| 195 | Ga0207653_10030662 | |||
| 196 | Ga0207684_10063934 | |||
| 197 | Ga0207684_10208870 | |||
| 198 | Ga0207663_10127012 | |||
| 199 | Ga0207646_10104426 | |||
| 200 | Ga0207664_10017893 | |||
| 201 | Ga0207686_10430893 | |||
| 202 | Ga0207709_10171674 | |||
| 203 | Ga0207665_10322523 | |||
| 204 | Ga0207667_10362948 | |||
| 205 | Ga0207712_10008738 | |||
| 206 | Ga0207712_10313382 | |||
| 207 | Ga0207641_10134855 | |||
| 208 | Ga0207648_10329907 | |||
| 209 | Ga0207676_10059478 | |||
| 210 | Ga0207698_10021062 | |||
| 211 | Ga0207698_10144842 | |||
| 212 | Ga0268266_10560777 | |||
| 213 | Ga0265334_10000006 | |||
| 214 | Ga0307515_10016077 | |||
| 215 | Ga0265338_10131408 | |||
| 216 | Ga0307408_100000026 | |||
| 217 | Ga0265313_10001064 | |||
| 218 | Ga0307508_10177521 | |||
| 219 | Ga0316575_10007741 | |||
| 220 | Ga0316579_10002038 | |||
| 221 | Ga0316578_10101686 | |||
| 222 | Ga0307516_10000023 | |||
| 223 | Ga0307516_10000845 | |||
| 224 | Ga0307516_10147308 | |||
| 225 | Ga0307516_10178601 | |||
| 226 | Ga0316577_10152912 | |||
| 227 | Ga0316585_10000635 | |||
| 228 | Ga0316580_10021831 | |||
| 229 | Ga0316593_10001480 | |||
| 230 | Ga0316574_0000365 | |||
| 231 | Ga0316574_0012662 | |||
| 232 | Ga0316574_0143977 | |||
| 233 | Ga0373924_0004791 | |||
| 234 | Ga0316582_0001843 | |||
| 235 | Ga0316582_0326899 | |||
| 236 | Ga0395905_0002773 | |||
| 237 | Ga0395905_0164700 | |||
| 238 | Ga0400483_056155 | |||
| 239 | Ga0450917_000109 | |||
| 240 | Ga0450890_000664 | |||
| 241 | Ga0450891_001879 | |||
| 242 | Ga0450889_000266 | |||
| 243 | Ga0439458_0012265 | |||
| 244 | Ga0450893_0003953 | |||
| 245 | Ga0451577_0001405 | |||
| 246 | Ga0451577_0015533 | |||
| 247 | Ga0466972_0067906 | |||
| 248 | Ga0453684_0189179 | |||
| 249 | Ga0453684_0235295 | |||
| 250 | Ga0453684_0335961 | |||
| 251 | Ga0466960_0177322 | |||
| 252 | Ga0451576_0011622 | |||
| 253 | Ga0495603_0000824 | |||
| 254 | Ga0495594_0004010 | |||
| 255 | Ga0495598_0113854 | |||
| 256 | Ga0495597_0031801 | |||
| 257 | Ga0495622_0000453 | |||
| 258 | Ga0495613_0134306 | |||
| 259 | Ga0495680_0111967 | |||
| 260 | Ga0496100_0291739 | |||
| 261 | Ga0496108_0111217 | |||
| 262 | Ga0496113_0228177 | |||
| 263 | Ga0496115_0150126 | |||
| 264 | Ga0496122_0060510 | |||
| 265 | Ga0496124_0034668 | |||
| 266 | Ga0496125_0040248 | |||
| 267 | Ga0496126_0035871 | |||
| 268 | Ga0495682_0015635 | |||
| 269 | Ga0501291_007656 | |||
| 270 | Ga0501314_000917 | |||
| 271 | Ga0501032_0041887 | |||
| 272 | Ga0501043_0000013 | |||
| 273 | Ga0501046_0000125 | |||
| 274 | Ga0501047_0000040 | |||
| 275 | Ga0501048_0002958 | |||
| 276 | Ga0501076_0059477 | |||
| 277 | Ga0501211_000812 | |||
| 278 | Ga0501222_002360 | |||
| 279 | Ga0501235_009427 | |||
| 280 | Ga0501255_002699 | |||
| 281 | Ga0501221_002791 | |||
| 282 | Ga0501272_001755 | |||
| 283 | Ga0501044_0057937 | |||
| 284 | Ga0501045_0015770 | |||
| 285 | nmdc:mga03683_34462_c1 | |||
| 286 | nmdc:mga07m45_48395_c1 | |||
| 287 | nmdc:mga06r32_137863_c1 | |||
| 288 | Ga0500607_164987 | |||
| 289 | Ga0500559_0050816 | |||
| 290 | Ga0500636_0043249 | |||
| 291 | Ga0500625_000897 | |||
| 292 | Ga0500645_027826 | |||
| 293 | 2512033169 | |||
| 294 | 2523102462 | |||
| 295 | 2599104879 | |||
| 296 | 2846544637 | |||
| 297 | 2846954400 | |||
| 298 | 2848859340 | |||
| 299 | 2897805477 | |||
| 300 | 8054005073 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zon-assembly2.cif.gz_D | histidinol phosphate phosphatase from mycobacterium tuberculosis | 0.858 | 9 | 254 |
| 4n81-assembly1.cif.gz_A-2 | another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis | 0.8579 | 2 | 254 |
| 5i3s-assembly1.cif.gz_A | crystal structure of staphylococcal impase-ii | 0.8579 | 7 | 254 |
| 3t0j-assembly1.cif.gz_A | crystal structure of inositol monophosphatase - ii from staphylococcus aureus mssa476 | 0.8564 | 7 | 254 |
| 5zon-assembly1.cif.gz_B | histidinol phosphate phosphatase from mycobacterium tuberculosis | 0.8554 | 9 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5zhhC01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.9016 | 6 | 149 | 3.30.540.10 |
| af_P22255_147_245_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.8857 | 159 | 255 | 3.40.190.80 |
| af_Q19420_7_150_3.30.540.10 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.8793 | 5 | 138 | 3.30.540.10 |
| 2pcrB01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.878 | 3 | 140 | 3.30.540.10 |
| af_P9WKJ1_154_255_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.8778 | 157 | 254 | 3.40.190.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H8XZ01-F1-model_v4 | 3'(2'),5'-bisphosphate nucleotidase CysQ (EC 3.1.3.7) (3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase) (3'-phosphoadenosine 5'-phosphate phosphatase) (PAP phosphatase) | 0.9597 | 3 | 255 |
GO:0000103
GO:0000287 GO:0005886 GO:0008441 GO:0050427 |
| AF-A0A2D7QXF9-F1-model_v4 | 3'(2'),5'-bisphosphate nucleotidase CysQ | 0.9594 | 104 | 255 |
GO:0000103
GO:0008441 GO:0046854 GO:0046872 GO:0050427 |
| AF-A0A1H8XZ01-F1-model_v4 | 3'(2'),5'-bisphosphate nucleotidase CysQ (EC 3.1.3.7) (3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase) (3'-phosphoadenosine 5'-phosphate phosphatase) (PAP phosphatase) | 0.9487 | 3 | 255 |
GO:0000103
GO:0000287 GO:0005886 GO:0008441 GO:0050427 |
| AF-A0A2P5VKA3-F1-model_v4 | 3'(2'),5'-bisphosphate nucleotidase CysQ | 0.9482 | 146 | 255 |
GO:0000103
GO:0008441 GO:0046854 GO:0046872 GO:0050427 |
| AF-A0A512NBV3-F1-model_v4 | 3'(2'),5'-bisphosphate nucleotidase CysQ (EC 3.1.3.7) (3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase) (3'-phosphoadenosine 5'-phosphate phosphatase) (PAP phosphatase) | 0.9458 | 1 | 255 |
GO:0000103
GO:0000287 GO:0005886 GO:0008441 GO:0046854 GO:0050427 |