F208174

General Info

Members Datasets Scaffolds Average Seq Length
150 128 300 261

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100330891|Ga0068867_1003308911
Length 298
Sequence MTLLTPLSNAMAARPAATMPGSPGSLAATDRPTEQRPAMSSSTPPPEMLDEVCRLARLAGQAVMAVYAQPITVRAKTDHSPVTQADEEAEALIIDGLSRLTPQIPIVAEEAVAAGRIPTLGERFWLVDPLDGTREFIDRNGEFTVNIALIEHGKPTLGVVFAPALSQTYSGVAGGPATLQDSRGEREIRCRAVPPEGLTVVASRSHGDEAALQSFLAGRRVAGLRHAGSSLKLCLIATGAADLYPRLGRTMEWDIAAGHAVLGAAGGRVCDLTGAELRYGKAGFANPHFVATGEAQRA

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
52 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
57 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
58 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
59 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
62 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
63 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
64 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
67 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
70 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
71 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
72 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
73 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
74 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
75 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
83 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
84 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
85 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
88 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
92 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
93 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
94 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
97 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
98 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
106 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
107 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
108 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
109 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
110 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
114 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
117 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
118 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
119 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
120 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
121 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
122 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
123 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
124 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
125 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
126 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
127 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
128 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.33
Metatranscriptomes 1.33
Isolates 5.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6
Nodule 0
Rhizoplane 2.67
Rhizosphere 77.33
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100330891 3300005459 Bacteria 1265
2 rootH1_10021069 3300003316 Bacteria 12095
3 rootL2_10005287 3300003322 Bacteria 8193
4 rootL2_10263564 3300003322 Bacteria 1886
5 rootH1_10022879 3300003323 Bacteria 4681
6 Ga0065715_10046455 3300005293 Bacteria 908
7 Ga0065715_10093838 3300005293 Bacteria 4534
8 Ga0065715_10255949 3300005293 Bacteria 1152
9 Ga0070670_100228107 3300005331 Bacteria 1621
10 Ga0070667_100655765 3300005367 Bacteria 969
11 Ga0070714_100015367 3300005435 Bacteria 6161
12 Ga0070714_100186944 3300005435 Bacteria 1888
13 Ga0070711_100312106 3300005439 Bacteria 1254
14 Ga0070708_100225407 3300005445 Bacteria 1758
15 Ga0070706_100015427 3300005467 Bacteria 7057
16 Ga0070706_100146356 3300005467 Bacteria 2206
17 Ga0070707_100308672 3300005468 Bacteria 1537
18 Ga0070699_100077100 3300005518 Bacteria 2901
19 Ga0070697_100009300 3300005536 Bacteria 7681
20 Ga0068855_100323422 3300005563 Bacteria 1704
21 Ga0068852_100052150 3300005616 Bacteria 3515
22 Ga0068852_100277265 3300005616 Bacteria 1615
23 Ga0068852_100315329 3300005616 Bacteria 1517
24 Ga0068864_100029918 3300005618 Bacteria 4616
25 Ga0068858_100347999 3300005842 Bacteria 1419
26 Ga0068862_100869357 3300005844 Bacteria 885
27 Ga0075362_10146214 3300006177 Bacteria 1132
28 Ga0075370_10104612 3300006353 Bacteria 1641
29 Ga0075428_100038441 3300006844 Bacteria 5266
30 Ga0075431_100092860 3300006847 Bacteria 3115
31 Ga0075435_100010626 3300007076 Bacteria 6737
32 Ga0105240_10130676 3300009093 Bacteria 3013
33 Ga0114129_10256270 3300009147 Bacteria 2347
34 Ga0114129_10581563 3300009147 Bacteria 1453
35 Ga0105242_10583706 3300009176 Bacteria 1077
36 Ga0105248_10013999 3300009177 Bacteria 8825
37 Ga0105238_10402267 3300009551 Bacteria 1363
38 Ga0105249_10002614 3300009553 Bacteria 15602
39 Ga0105032_100071 3300009979 Bacteria 11396
40 Ga0105239_10207268 3300010375 Bacteria 2197
41 Ga0105239_11097144 3300010375 Bacteria 916
42 Ga0157374_10041708 3300013296 Bacteria 4231
43 Ga0163162_10589592 3300013306 Bacteria 1238
44 Ga0157379_10010225 3300014968 Bacteria 8173
45 Ga0207653_10030662 3300025885 Bacteria 1735
46 Ga0207684_10063934 3300025910 Bacteria 3124
47 Ga0207684_10208870 3300025910 Bacteria 1684
48 Ga0207663_10127012 3300025916 Bacteria 1756
49 Ga0207646_10104426 3300025922 Bacteria 2541
50 Ga0207664_10017893 3300025929 Bacteria 5207
51 Ga0207686_10430893 3300025934 Bacteria 1011
52 Ga0207709_10171674 3300025935 Bacteria 1522
53 Ga0207665_10322523 3300025939 Bacteria 1159
54 Ga0207667_10362948 3300025949 Bacteria 1477
55 Ga0207712_10008738 3300025961 Bacteria 6407
56 Ga0207712_10313382 3300025961 Bacteria 1292
57 Ga0207641_10134855 3300026088 Bacteria 2221
58 Ga0207648_10329907 3300026089 Bacteria 1372
59 Ga0207676_10059478 3300026095 Bacteria 3018
60 Ga0207698_10021062 3300026142 Bacteria 4501
61 Ga0207698_10144842 3300026142 Bacteria 2053
62 Ga0268266_10560777 3300028379 Bacteria 1095
63 Ga0265334_10000006 3300028573 Bacteria 235168
64 Ga0307515_10016077 3300028794 Bacteria 13730
65 Ga0265338_10131408 3300028800 Bacteria 1976
66 Ga0307408_100000026 3300031548 Bacteria 261688
67 Ga0265313_10001064 3300031595 Bacteria 26581
68 Ga0307508_10177521 3300031616 Bacteria 1733
69 Ga0316575_10007741 3300031665 Bacteria 3897
70 Ga0316579_10002038 3300031691 Bacteria 7564
71 Ga0316578_10101686 3300031728 Bacteria 1723
72 Ga0307516_10000023 3300031730 Bacteria 190971
73 Ga0307516_10000845 3300031730 Bacteria 42008
74 Ga0307516_10147308 3300031730 Bacteria 2119
75 Ga0307516_10178601 3300031730 Bacteria 1858
76 Ga0316577_10152912 3300031733 Bacteria 1300
77 Ga0316585_10000635 3300032137 Bacteria 8665
78 Ga0316580_10021831 3300032139 Bacteria 1975
79 Ga0316593_10001480 3300032168 Bacteria 5191
80 Ga0316574_0000365 3300035398 Bacteria 17593
81 Ga0316574_0012662 3300035398 Bacteria 4830
82 Ga0316574_0143977 3300035398 Bacteria 1536
83 Ga0373924_0004791 3300035410 Bacteria 4751
84 Ga0316582_0001843 3300036647 Bacteria 9595
85 Ga0316582_0326899 3300036647 Bacteria 1054
86 Ga0395905_0002773 3300037471 Bacteria 19196
87 Ga0395905_0164700 3300037471 Bacteria 2083
88 Ga0400483_056155 3300039062 Unclassified 2095
89 Ga0450917_000109 3300042120 Bacteria 5085
90 Ga0450890_000664 3300042127 Bacteria 5016
91 Ga0450891_001879 3300042129 Bacteria 2154
92 Ga0450889_000266 3300042144 Bacteria 5808
93 Ga0439458_0012265 3300042157 Bacteria 1922
94 Ga0450893_0003953 3300042532 Bacteria 2351
95 Ga0451577_0001405 3300042876 Bacteria 32181
96 Ga0451577_0015533 3300042876 Bacteria 7081
97 Ga0466972_0067906 3300044658 Bacteria 1703
98 Ga0453684_0189179 3300044712 Bacteria 2409
99 Ga0453684_0235295 3300044712 Bacteria 2112
100 Ga0453684_0335961 3300044712 Bacteria 1707
101 Ga0466960_0177322 3300044901 Bacteria 1153
102 Ga0451576_0011622 3300045051 Bacteria 9975
103 Ga0495603_0000824 3300046455 Bacteria 17836
104 Ga0495594_0004010 3300046499 Bacteria 7576
105 Ga0495598_0113854 3300046537 Bacteria 910
106 Ga0495597_0031801 3300046542 Bacteria 2398
107 Ga0495622_0000453 3300046557 Bacteria 26308
108 Ga0495613_0134306 3300046689 Bacteria 1771
109 Ga0495680_0111967 3300047322 Bacteria 2022
110 Ga0496100_0291739 3300048903 Bacteria 1219
111 Ga0496108_0111217 3300048911 Bacteria 2343
112 Ga0496113_0228177 3300048916 Bacteria 1484
113 Ga0496115_0150126 3300048918 Bacteria 1924
114 Ga0496122_0060510 3300048925 Bacteria 2789
115 Ga0496124_0034668 3300048927 Bacteria 4425
116 Ga0496125_0040248 3300048928 Bacteria 4012
117 Ga0496126_0035871 3300048929 Bacteria 4642
118 Ga0495682_0015635 3300049460 Bacteria 2875
119 Ga0501291_007656 3300049514 Bacteria 1471
120 Ga0501314_000917 3300049530 Bacteria 1984
121 Ga0501032_0041887 3300049569 Bacteria 3108
122 Ga0501043_0000013 3300049579 Bacteria 185639
123 Ga0501046_0000125 3300049580 Bacteria 81656
124 Ga0501047_0000040 3300049581 Bacteria 185677
125 Ga0501048_0002958 3300049582 Bacteria 12974
126 Ga0501076_0059477 3300049592 Bacteria 3040
127 Ga0501211_000812 3300049658 Bacteria 3235
128 Ga0501222_002360 3300049662 Bacteria 2620
129 Ga0501235_009427 3300049669 Bacteria 2133
130 Ga0501255_002699 3300049684 Bacteria 1583
131 Ga0501221_002791 3300049704 Bacteria 2874
132 Ga0501272_001755 3300049769 Bacteria 2098
133 Ga0501044_0057937 3300049823 Bacteria 3974
134 Ga0501045_0015770 3300049824 Bacteria 5360
135 nmdc:mga03683_34462_c1 3300050489 Bacteria 2048
136 nmdc:mga07m45_48395_c1 3300050496 Bacteria 2391
137 nmdc:mga06r32_137863_c1 3300050510 Bacteria 2414
138 Ga0500607_164987 3300053121 Bacteria 1006
139 Ga0500559_0050816 3300053136 Bacteria 1830
140 Ga0500636_0043249 3300053177 Bacteria 2659
141 Ga0500625_000897 3300053729 Bacteria 9271
142 Ga0500645_027826 3300053730 Bacteria 1713
143 2512033169 2511231221 Bacteria 6846400
144 2523102462 2522572158 Bacteria 6514390
145 2599104879 2597490356 Bacteria 7030811
146 2846544637 2846540461 Bacteria 5471451
147 2846954400 2846952575 Bacteria 6587527
148 2848859340 2848858292 Bacteria 7391279
149 2897805477 2897803580 Bacteria 7000062
150 8054005073 8054002106 Bacteria 7987183
151 Ga0068867_100330891
152 rootH1_10021069
153 rootL2_10005287
154 rootL2_10263564
155 rootH1_10022879
156 Ga0065715_10046455
157 Ga0065715_10093838
158 Ga0065715_10255949
159 Ga0070670_100228107
160 Ga0070667_100655765
161 Ga0070714_100015367
162 Ga0070714_100186944
163 Ga0070711_100312106
164 Ga0070708_100225407
165 Ga0070706_100015427
166 Ga0070706_100146356
167 Ga0070707_100308672
168 Ga0070699_100077100
169 Ga0070697_100009300
170 Ga0068855_100323422
171 Ga0068852_100052150
172 Ga0068852_100277265
173 Ga0068852_100315329
174 Ga0068864_100029918
175 Ga0068858_100347999
176 Ga0068862_100869357
177 Ga0075362_10146214
178 Ga0075370_10104612
179 Ga0075428_100038441
180 Ga0075431_100092860
181 Ga0075435_100010626
182 Ga0105240_10130676
183 Ga0114129_10256270
184 Ga0114129_10581563
185 Ga0105242_10583706
186 Ga0105248_10013999
187 Ga0105238_10402267
188 Ga0105249_10002614
189 Ga0105032_100071
190 Ga0105239_10207268
191 Ga0105239_11097144
192 Ga0157374_10041708
193 Ga0163162_10589592
194 Ga0157379_10010225
195 Ga0207653_10030662
196 Ga0207684_10063934
197 Ga0207684_10208870
198 Ga0207663_10127012
199 Ga0207646_10104426
200 Ga0207664_10017893
201 Ga0207686_10430893
202 Ga0207709_10171674
203 Ga0207665_10322523
204 Ga0207667_10362948
205 Ga0207712_10008738
206 Ga0207712_10313382
207 Ga0207641_10134855
208 Ga0207648_10329907
209 Ga0207676_10059478
210 Ga0207698_10021062
211 Ga0207698_10144842
212 Ga0268266_10560777
213 Ga0265334_10000006
214 Ga0307515_10016077
215 Ga0265338_10131408
216 Ga0307408_100000026
217 Ga0265313_10001064
218 Ga0307508_10177521
219 Ga0316575_10007741
220 Ga0316579_10002038
221 Ga0316578_10101686
222 Ga0307516_10000023
223 Ga0307516_10000845
224 Ga0307516_10147308
225 Ga0307516_10178601
226 Ga0316577_10152912
227 Ga0316585_10000635
228 Ga0316580_10021831
229 Ga0316593_10001480
230 Ga0316574_0000365
231 Ga0316574_0012662
232 Ga0316574_0143977
233 Ga0373924_0004791
234 Ga0316582_0001843
235 Ga0316582_0326899
236 Ga0395905_0002773
237 Ga0395905_0164700
238 Ga0400483_056155
239 Ga0450917_000109
240 Ga0450890_000664
241 Ga0450891_001879
242 Ga0450889_000266
243 Ga0439458_0012265
244 Ga0450893_0003953
245 Ga0451577_0001405
246 Ga0451577_0015533
247 Ga0466972_0067906
248 Ga0453684_0189179
249 Ga0453684_0235295
250 Ga0453684_0335961
251 Ga0466960_0177322
252 Ga0451576_0011622
253 Ga0495603_0000824
254 Ga0495594_0004010
255 Ga0495598_0113854
256 Ga0495597_0031801
257 Ga0495622_0000453
258 Ga0495613_0134306
259 Ga0495680_0111967
260 Ga0496100_0291739
261 Ga0496108_0111217
262 Ga0496113_0228177
263 Ga0496115_0150126
264 Ga0496122_0060510
265 Ga0496124_0034668
266 Ga0496125_0040248
267 Ga0496126_0035871
268 Ga0495682_0015635
269 Ga0501291_007656
270 Ga0501314_000917
271 Ga0501032_0041887
272 Ga0501043_0000013
273 Ga0501046_0000125
274 Ga0501047_0000040
275 Ga0501048_0002958
276 Ga0501076_0059477
277 Ga0501211_000812
278 Ga0501222_002360
279 Ga0501235_009427
280 Ga0501255_002699
281 Ga0501221_002791
282 Ga0501272_001755
283 Ga0501044_0057937
284 Ga0501045_0015770
285 nmdc:mga03683_34462_c1
286 nmdc:mga07m45_48395_c1
287 nmdc:mga06r32_137863_c1
288 Ga0500607_164987
289 Ga0500559_0050816
290 Ga0500636_0043249
291 Ga0500625_000897
292 Ga0500645_027826
293 2512033169
294 2523102462
295 2599104879
296 2846544637
297 2846954400
298 2848859340
299 2897805477
300 8054005073

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

45

297

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zon-assembly2.cif.gz_D histidinol phosphate phosphatase from mycobacterium tuberculosis 0.858 9 254
4n81-assembly1.cif.gz_A-2 another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis 0.8579 2 254
5i3s-assembly1.cif.gz_A crystal structure of staphylococcal impase-ii 0.8579 7 254
3t0j-assembly1.cif.gz_A crystal structure of inositol monophosphatase - ii from staphylococcus aureus mssa476 0.8564 7 254
5zon-assembly1.cif.gz_B histidinol phosphate phosphatase from mycobacterium tuberculosis 0.8554 9 254
ID Description Score Start End Superfamily
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9016 6 149 3.30.540.10
af_P22255_147_245_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.8857 159 255 3.40.190.80
af_Q19420_7_150_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8793 5 138 3.30.540.10
2pcrB01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.878 3 140 3.30.540.10
af_P9WKJ1_154_255_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.8778 157 254 3.40.190.80
ID Description Score Start End GO Terms
AF-A0A1H8XZ01-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ (EC 3.1.3.7) (3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase) (3'-phosphoadenosine 5'-phosphate phosphatase) (PAP phosphatase) 0.9597 3 255 GO:0000103
GO:0000287
GO:0005886
GO:0008441
GO:0050427
AF-A0A2D7QXF9-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ 0.9594 104 255 GO:0000103
GO:0008441
GO:0046854
GO:0046872
GO:0050427
AF-A0A1H8XZ01-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ (EC 3.1.3.7) (3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase) (3'-phosphoadenosine 5'-phosphate phosphatase) (PAP phosphatase) 0.9487 3 255 GO:0000103
GO:0000287
GO:0005886
GO:0008441
GO:0050427
AF-A0A2P5VKA3-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ 0.9482 146 255 GO:0000103
GO:0008441
GO:0046854
GO:0046872
GO:0050427
AF-A0A512NBV3-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ (EC 3.1.3.7) (3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase) (3'-phosphoadenosine 5'-phosphate phosphatase) (PAP phosphatase) 0.9458 1 255 GO:0000103
GO:0000287
GO:0005886
GO:0008441
GO:0046854
GO:0050427

Map