F207086

General Info

Members Datasets Scaffolds Average Seq Length
149 88 298 370

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0141201|Ga0496115_0141201_384_1553
Length 389
Sequence MGRYDLDQRVVMTLDAGGTSFRFSAMRGNKPVTPTVVLPSNGDNLERCLATLLDGFAATKQKCPGQPIAISFAFPGPADYPKGIIGDLPNLPAFRGGVALGPMLEDAFGIPVFVNNDGDLFAYGEAIAGFLPWINRQLEEAGSPKRYKNLFGLTLGTGLGGGIVRNNELFIGDNSIAGEVWLLRNKLAPAMNAEEGACIRAVRRVYAERAHIPIAQAPEPKSICDIGLGIEPGDCAAAVEAFRQLGEIVGDVLATALTLVDGLAVIGGGLSSAWPLFLDEAVRELNSAYVGPGGNSFPRLASKAFNLQDRAQTEKFLQGEVREIAVPHSRRKIQYDPLRRAGIGISRLGTSQAIAIGAYAFALRQLDTRQTPAAHTADQGTGFIGAVNS

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
12 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
13 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
14 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
15 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
21 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
22 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
23 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
24 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
25 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
26 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
27 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
28 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
29 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
30 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
31 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
32 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
33 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
34 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
35 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
36 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
37 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
38 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
39 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
40 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
41 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
42 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
43 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
44 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
45 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
46 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
47 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
48 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
49 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
50 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
51 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
52 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
53 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
54 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
55 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
59 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
60 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
61 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
62 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
63 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
64 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
65 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
66 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
67 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
68 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
69 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
70 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
71 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
72 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
73 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
74 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
75 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
78 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
83 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
84 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
85 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
86 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
87 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
88 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 0
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.36
Nodule 0
Rhizoplane 2.01
Rhizosphere 89.26
Stem 0
Stem Tuber 0
Unclassified 20.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0141201 3300048918 Bacteria 1987
2 rootH2_10041297 3300003320 Bacteria 3112
3 rootH2_10045742 3300003320 Bacteria 5276
4 rootL2_10331254 3300003322 Bacteria 1890
5 Ga0070689_100257018 3300005340 Bacteria 1443
6 Ga0070661_100225297 3300005344 Unclassified 1439
7 Ga0070714_100048888 3300005435 Bacteria 3599
8 Ga0070681_10026417 3300005458 Bacteria 5834
9 Ga0070679_100125415 3300005530 Bacteria 2550
10 Ga0070665_100338712 3300005548 Bacteria 1509
11 Ga0068855_100191716 3300005563 Unclassified 2305
12 Ga0105240_10170910 3300009093 Unclassified 2575
13 Ga0105240_10190351 3300009093 Bacteria 2413
14 Ga0105238_10034579 3300009551 Bacteria 5141
15 Ga0157370_10048029 3300013104 Bacteria 4089
16 Ga0157376_10315109 3300014969 Unclassified 1485
17 Ga0207707_10107146 3300025912 Bacteria 2443
18 Ga0207663_10177157 3300025916 Unclassified 1519
19 Ga0207694_10149485 3300025924 Bacteria 1881
20 Ga0207667_10227747 3300025949 Bacteria 1909
21 Ga0207702_10060701 3300026078 Unclassified 3223
22 Ga0265337_1005703 3300028556 Bacteria 4899
23 Ga0265337_1008933 3300028556 Unclassified 3610
24 Ga0265326_10001453 3300028558 Bacteria 8336
25 Ga0265326_10008345 3300028558 Bacteria 3126
26 Ga0265319_1003717 3300028563 Bacteria 7843
27 Ga0265319_1005393 3300028563 Bacteria 6122
28 Ga0265334_10022444 3300028573 Unclassified 2571
29 Ga0265334_10036090 3300028573 Unclassified 1953
30 Ga0265334_10040955 3300028573 Unclassified 1812
31 Ga0265318_10000026 3300028577 Bacteria 158673
32 Ga0265318_10013509 3300028577 Unclassified 3450
33 Ga0265318_10014035 3300028577 Unclassified 3366
34 Ga0265318_10015779 3300028577 Unclassified 3134
35 Ga0265323_10000519 3300028653 Bacteria 21449
36 Ga0265336_10000297 3300028666 Bacteria 33837
37 Ga0265336_10001488 3300028666 Bacteria 10636
38 Ga0265338_10000124 3300028800 Bacteria 141312
39 Ga0265338_10000143 3300028800 Bacteria 132132
40 Ga0265338_10000291 3300028800 Bacteria 90081
41 Ga0265338_10001100 3300028800 Bacteria 44993
42 Ga0265338_10005280 3300028800 Bacteria 16912
43 Ga0265338_10005773 3300028800 Bacteria 16003
44 Ga0265338_10045459 3300028800 Bacteria 4036
45 Ga0265338_10060297 3300028800 Bacteria 3335
46 Ga0265324_10000355 3300029957 Bacteria 33214
47 Ga0265324_10028090 3300029957 Bacteria 1985
48 Ga0265330_10000850 3300031235 Bacteria 19158
49 Ga0265332_10006692 3300031238 Bacteria 5220
50 Ga0265332_10037827 3300031238 Bacteria 2092
51 Ga0265320_10004119 3300031240 Bacteria 9551
52 Ga0265320_10005630 3300031240 Bacteria 8004
53 Ga0265325_10009098 3300031241 Bacteria 5819
54 Ga0265329_10000880 3300031242 Bacteria 15177
55 Ga0265329_10003386 3300031242 Bacteria 6957
56 Ga0265340_10003365 3300031247 Bacteria 9037
57 Ga0265340_10013147 3300031247 Unclassified 4355
58 Ga0265340_10034117 3300031247 Bacteria 2531
59 Ga0265339_10001197 3300031249 Bacteria 19550
60 Ga0265339_10016349 3300031249 Bacteria 4424
61 Ga0265331_10000829 3300031250 Bacteria 25224
62 Ga0265331_10101807 3300031250 Unclassified 1321
63 Ga0265316_10001086 3300031344 Bacteria 29444
64 Ga0265316_10002184 3300031344 Bacteria 20553
65 Ga0265316_10003998 3300031344 Bacteria 14762
66 Ga0265316_10053524 3300031344 Unclassified 3162
67 Ga0265316_10167335 3300031344 Bacteria 1641
68 Ga0265313_10000059 3300031595 Bacteria 107320
69 Ga0265313_10052729 3300031595 Bacteria 1940
70 Ga0265313_10071064 3300031595 Unclassified 1602
71 Ga0265314_10000526 3300031711 Bacteria 49354
72 Ga0265314_10004075 3300031711 Bacteria 13787
73 Ga0265314_10010387 3300031711 Bacteria 7771
74 Ga0265314_10054708 3300031711 Bacteria 2760
75 Ga0265342_10014926 3300031712 Bacteria 5133
76 Ga0316576_10007856 3300031727 Bacteria 6745
77 Ga0316578_10011565 3300031728 Bacteria 4624
78 Ga0316577_10059900 3300031733 Bacteria 2125
79 Ga0316580_10041715 3300032139 Bacteria 1417
80 Ga0373929_0000109 3300035085 Bacteria 13551
81 Ga0373932_0000001 3300035112 Bacteria 1459067
82 Ga0373962_0000096 3300035242 Bacteria 19253
83 Ga0373931_0000004 3300035691 Bacteria 535140
84 Ga0316584_0002587 3300036712 Bacteria 11503
85 Ga0400483_055773 3300039062 Unclassified 1955
86 Ga0400483_119207 3300039062 Bacteria 30707
87 Ga0400483_153953 3300039062 Bacteria 33873
88 Ga0436360_1307773 3300039438 Unclassified 3987
89 Ga0451795_0655539 3300041456 Bacteria 2372
90 Ga0451795_1060159 3300041456 Unclassified 1552
91 Ga0451855_0909681 3300041511 Bacteria 3593
92 Ga0451855_2063567 3300041511 Bacteria 2896
93 Ga0451577_0001038 3300042876 Bacteria 40222
94 Ga0451577_0123043 3300042876 Bacteria 2324
95 Ga0451577_0208855 3300042876 Unclassified 1763
96 Ga0453683_0102288 3300044673 Bacteria 1799
97 Ga0453684_0000010 3300044712 Bacteria 1133422
98 Ga0453684_0001984 3300044712 Bacteria 52481
99 Ga0453684_0003364 3300044712 Bacteria 36170
100 Ga0453684_0033920 3300044712 Bacteria 7101
101 Ga0453684_0042782 3300044712 Bacteria 6100
102 Ga0453684_0074702 3300044712 Bacteria 4266
103 Ga0453684_0074795 3300044712 Bacteria 4262
104 Ga0453684_0179619 3300044712 Bacteria 2485
105 Ga0453684_0402143 3300044712 Unclassified 1533
106 Ga0453684_0429214 3300044712 Unclassified 1475
107 Ga0451576_0000264 3300045051 Bacteria 128283
108 Ga0451576_0124804 3300045051 Bacteria 2682
109 Ga0451576_0163103 3300045051 Bacteria 2326
110 Ga0451576_0236566 3300045051 Unclassified 1908
111 Ga0451576_0400249 3300045051 Unclassified 1440
112 Ga0495627_002591 3300046453 Bacteria 8547
113 Ga0495592_0000053 3300046454 Bacteria 108449
114 Ga0495641_0109044 3300046461 Bacteria 1235
115 Ga0495662_0016116 3300046476 Bacteria 3624
116 Ga0495664_0002888 3300046477 Bacteria 9267
117 Ga0495618_0003041 3300046514 Bacteria 10592
118 Ga0495628_0000091 3300046516 Bacteria 71204
119 Ga0495630_0000039 3300046517 Bacteria 108982
120 Ga0495630_0002016 3300046517 Bacteria 14119
121 Ga0495666_0002375 3300046526 Bacteria 9385
122 Ga0495666_0010848 3300046526 Bacteria 4544
123 Ga0495652_0037598 3300046529 Bacteria 4198
124 Ga0495640_0028977 3300046533 Unclassified 3981
125 Ga0495586_0000022 3300046535 Bacteria 108323
126 Ga0495586_0000317 3300046535 Bacteria 30578
127 Ga0495645_0003182 3300046543 Bacteria 11124
128 Ga0495634_0051641 3300046642 Bacteria 2758
129 Ga0495634_0060452 3300046642 Bacteria 2521
130 Ga0495599_0076815 3300046678 Unclassified 2085
131 Ga0495646_0096937 3300046680 Unclassified 1695
132 Ga0495647_0038067 3300046681 Bacteria 1818
133 Ga0495658_0152707 3300046683 Unclassified 1419
134 Ga0495613_0217411 3300046689 Bacteria 1342
135 Ga0495624_0021451 3300046690 Bacteria 4282
136 Ga0495581_0127519 3300047315 Bacteria 1482
137 Ga0495674_0000513 3300047319 Bacteria 35527
138 Ga0495674_0001356 3300047319 Bacteria 23874
139 Ga0495674_0081383 3300047319 Bacteria 2778
140 Ga0495676_0056709 3300047321 Bacteria 3096
141 Ga0501034_0188528 3300049571 Unclassified 2025
142 Ga0500562_011619 3300053108 Bacteria 2235
143 Ga0500655_003914 3300053133 Unclassified 2687
144 Ga0500604_0000199 3300053151 Bacteria 17062
145 Ga0500622_0000032 3300053156 Bacteria 205634
146 Ga0500622_0000036 3300053156 Bacteria 181221
147 2896320595 2896317667 Bacteria 4606601
148 2896345456 2896344016 Bacteria 3811746
149 2920113830 2920107658 Bacteria 10042636
150 Ga0496115_0141201
151 rootH2_10041297
152 rootH2_10045742
153 rootL2_10331254
154 Ga0070689_100257018
155 Ga0070661_100225297
156 Ga0070714_100048888
157 Ga0070681_10026417
158 Ga0070679_100125415
159 Ga0070665_100338712
160 Ga0068855_100191716
161 Ga0105240_10170910
162 Ga0105240_10190351
163 Ga0105238_10034579
164 Ga0157370_10048029
165 Ga0157376_10315109
166 Ga0207707_10107146
167 Ga0207663_10177157
168 Ga0207694_10149485
169 Ga0207667_10227747
170 Ga0207702_10060701
171 Ga0265337_1005703
172 Ga0265337_1008933
173 Ga0265326_10001453
174 Ga0265326_10008345
175 Ga0265319_1003717
176 Ga0265319_1005393
177 Ga0265334_10022444
178 Ga0265334_10036090
179 Ga0265334_10040955
180 Ga0265318_10000026
181 Ga0265318_10013509
182 Ga0265318_10014035
183 Ga0265318_10015779
184 Ga0265323_10000519
185 Ga0265336_10000297
186 Ga0265336_10001488
187 Ga0265338_10000124
188 Ga0265338_10000143
189 Ga0265338_10000291
190 Ga0265338_10001100
191 Ga0265338_10005280
192 Ga0265338_10005773
193 Ga0265338_10045459
194 Ga0265338_10060297
195 Ga0265324_10000355
196 Ga0265324_10028090
197 Ga0265330_10000850
198 Ga0265332_10006692
199 Ga0265332_10037827
200 Ga0265320_10004119
201 Ga0265320_10005630
202 Ga0265325_10009098
203 Ga0265329_10000880
204 Ga0265329_10003386
205 Ga0265340_10003365
206 Ga0265340_10013147
207 Ga0265340_10034117
208 Ga0265339_10001197
209 Ga0265339_10016349
210 Ga0265331_10000829
211 Ga0265331_10101807
212 Ga0265316_10001086
213 Ga0265316_10002184
214 Ga0265316_10003998
215 Ga0265316_10053524
216 Ga0265316_10167335
217 Ga0265313_10000059
218 Ga0265313_10052729
219 Ga0265313_10071064
220 Ga0265314_10000526
221 Ga0265314_10004075
222 Ga0265314_10010387
223 Ga0265314_10054708
224 Ga0265342_10014926
225 Ga0316576_10007856
226 Ga0316578_10011565
227 Ga0316577_10059900
228 Ga0316580_10041715
229 Ga0373929_0000109
230 Ga0373932_0000001
231 Ga0373962_0000096
232 Ga0373931_0000004
233 Ga0316584_0002587
234 Ga0400483_055773
235 Ga0400483_119207
236 Ga0400483_153953
237 Ga0436360_1307773
238 Ga0451795_0655539
239 Ga0451795_1060159
240 Ga0451855_0909681
241 Ga0451855_2063567
242 Ga0451577_0001038
243 Ga0451577_0123043
244 Ga0451577_0208855
245 Ga0453683_0102288
246 Ga0453684_0000010
247 Ga0453684_0001984
248 Ga0453684_0003364
249 Ga0453684_0033920
250 Ga0453684_0042782
251 Ga0453684_0074702
252 Ga0453684_0074795
253 Ga0453684_0179619
254 Ga0453684_0402143
255 Ga0453684_0429214
256 Ga0451576_0000264
257 Ga0451576_0124804
258 Ga0451576_0163103
259 Ga0451576_0236566
260 Ga0451576_0400249
261 Ga0495627_002591
262 Ga0495592_0000053
263 Ga0495641_0109044
264 Ga0495662_0016116
265 Ga0495664_0002888
266 Ga0495618_0003041
267 Ga0495628_0000091
268 Ga0495630_0000039
269 Ga0495630_0002016
270 Ga0495666_0002375
271 Ga0495666_0010848
272 Ga0495652_0037598
273 Ga0495640_0028977
274 Ga0495586_0000022
275 Ga0495586_0000317
276 Ga0495645_0003182
277 Ga0495634_0051641
278 Ga0495634_0060452
279 Ga0495599_0076815
280 Ga0495646_0096937
281 Ga0495647_0038067
282 Ga0495658_0152707
283 Ga0495613_0217411
284 Ga0495624_0021451
285 Ga0495581_0127519
286 Ga0495674_0000513
287 Ga0495674_0001356
288 Ga0495674_0081383
289 Ga0495676_0056709
290 Ga0501034_0188528
291 Ga0500562_011619
292 Ga0500655_003914
293 Ga0500604_0000199
294 Ga0500622_0000032
295 Ga0500622_0000036
296 2896320595
297 2896345456
298 2920113830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

11

310

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mcp-assembly1.cif.gz_A-2 crystal structure of glucokinase (bdi_1628) from parabacteroides distasonis atcc 8503 at 3.00 a resolution 0.9308 1 363
3mcp-assembly1.cif.gz_A-2 crystal structure of glucokinase (bdi_1628) from parabacteroides distasonis atcc 8503 at 3.00 a resolution 0.9233 1 363
5nck-assembly1.cif.gz_B the crystal structure of n-acetylmannosamine kinase in fusobacterium nucleatum 0.8617 9 365
5nck-assembly1.cif.gz_B the crystal structure of n-acetylmannosamine kinase in fusobacterium nucleatum 0.8479 9 365
3vov-assembly1.cif.gz_B crystal structure of rok hexokinase from thermus thermophilus 0.8176 9 366
ID Description Score Start End Superfamily
3mcpA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9832 4 114 3.30.420.40
3mcpA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9658 4 114 3.30.420.40
3mcpA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9538 115 363 3.30.420.40
3mcpA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9419 115 363 3.30.420.40
3vovB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8944 9 124 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A2N2VTE3-F1-model_v4 ROK family protein 0.9892 143 368 GO:0003824
AF-A0A1V5QY20-F1-model_v4 N-acetyl-D-glucosamine kinase (EC 2.7.1.59) 0.9851 1 368 GO:0045127
AF-A0A7X7U1A2-F1-model_v4 ROK family protein 0.9847 1 366 GO:0003824
AF-A0A1V5QY20-F1-model_v4 N-acetyl-D-glucosamine kinase (EC 2.7.1.59) 0.9825 1 368 GO:0045127
AF-A0A7S7SQA6-F1-model_v4 ROK family protein 0.9819 12 364 GO:0003824

Map