F207011

General Info

Members Datasets Scaffolds Average Seq Length
149 104 149 306

Family's Representative Sequence

Representative Sequence 3300047446|Ga0495679_026423|Ga0495679_026423_197_1252
Length 351
Sequence MRELLFRNPKEQRDRRRWQMSALQPGAGTGDLSGGATNAPRQAGGLAEPAAVSSCLSQNEERLAWIFGSSRSGSTWLLRMLAELDGVVAIDDPHLGHHLGVWRPIPLAWATSEEQPELATLLELKGEEPCYFFSEQHRESWWEPLRGLIQARFESQAGAEATAGLTYVVKEPGSHVAPLLCELFPRSKLIFLLRDGRDVVDSWLDAHQQGSWAIAGGAFPVSAEGRIPLIRWLSSVWAYRTRAVRRAFESRDPDSRVLVRYEDLRDATSQTMEEICEMLGLDRTGLAEVVDEHRFERLPSTARGSGQERRLATPGAWQERLSLEEQEAMHEAMGEALEEFGYQVPDPVPVG

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
79 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
80 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
81 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
92 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
96 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 12.75
Rhizosphere 85.23
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1002088 3300001977 Bacteria 3192
2 rootL2_10271559 3300003322 Bacteria 1350
3 Ga0070683_100000855 3300005329 Bacteria 22514
4 Ga0070683_100021855 3300005329 Bacteria 5711
5 Ga0070683_100022176 3300005329 Bacteria 5674
6 Ga0070677_10000016 3300005333 Bacteria 52044
7 Ga0068868_100003834 3300005338 Bacteria 10495
8 Ga0068868_100167772 3300005338 Bacteria 1816
9 Ga0070660_100362175 3300005339 Bacteria 1195
10 Ga0070689_100212715 3300005340 Unclassified 1583
11 Ga0070687_100106575 3300005343 Bacteria 1579
12 Ga0070661_100000004 3300005344 Bacteria 243876
13 Ga0070675_100000078 3300005354 Bacteria 56469
14 Ga0070673_100075304 3300005364 Unclassified 2722
15 Ga0070688_100000113 3300005365 Bacteria 42091
16 Ga0070688_100000271 3300005365 Bacteria 26844
17 Ga0070659_100055636 3300005366 Bacteria 3119
18 Ga0070700_100304249 3300005441 Unclassified 1165
19 Ga0070685_10000012 3300005466 Bacteria 128823
20 Ga0070685_10000627 3300005466 Bacteria 19323
21 Ga0070685_10077151 3300005466 Bacteria 1989
22 Ga0070684_100003218 3300005535 Bacteria 12217
23 Ga0070684_100015887 3300005535 Bacteria 6144
24 Ga0070684_100070922 3300005535 Bacteria 3067
25 Ga0068853_100112381 3300005539 Unclassified 2421
26 Ga0070672_100000049 3300005543 Bacteria 52233
27 Ga0070686_100041550 3300005544 Unclassified 2875
28 Ga0070664_100052445 3300005564 Bacteria 3455
29 Ga0068856_100013015 3300005614 Bacteria 8056
30 Ga0068856_100025853 3300005614 Bacteria 5725
31 Ga0068852_100000022 3300005616 Bacteria 125196
32 Ga0068864_100000023 3300005618 Bacteria 257064
33 Ga0081455_10003113 3300005937 Bacteria 19316
34 Ga0081538_10001950 3300005981 Bacteria 20667
35 Ga0081538_10009071 3300005981 Bacteria 8344
36 Ga0081538_10009134 3300005981 Bacteria 8314
37 Ga0081540_1003574 3300005983 Bacteria 12220
38 Ga0075365_10013772 3300006038 Bacteria 4851
39 Ga0070712_100003550 3300006175 Bacteria 9603
40 Ga0075428_100000315 3300006844 Bacteria 47699
41 Ga0075428_100098081 3300006844 Unclassified 3195
42 Ga0075430_100151544 3300006846 Bacteria 1931
43 Ga0075431_100000083 3300006847 Bacteria 56463
44 Ga0075431_100169680 3300006847 Bacteria 2242
45 Ga0075433_10042306 3300006852 Bacteria 3952
46 Ga0075434_100042078 3300006871 Unclassified 4529
47 Ga0068865_100000061 3300006881 Bacteria 57211
48 Ga0111539_10083466 3300009094 Bacteria 3757
49 Ga0111539_10132402 3300009094 Bacteria 2920
50 Ga0105245_10000023 3300009098 Bacteria 180844
51 Ga0105245_10000049 3300009098 Bacteria 128277
52 Ga0105245_10005504 3300009098 Bacteria 11123
53 Ga0114129_10081954 3300009147 Bacteria 4484
54 Ga0105243_10006741 3300009148 Bacteria 8861
55 Ga0105248_10000245 3300009177 Bacteria 62951
56 Ga0105246_10057811 3300011119 Bacteria 2685
57 Ga0157371_10001441 3300013102 Bacteria 24694
58 Ga0157370_10096668 3300013104 Unclassified 2771
59 Ga0157369_10000014 3300013105 Bacteria 266411
60 Ga0157378_10085619 3300013297 Bacteria 2855
61 Ga0207682_10000008 3300025893 Bacteria 87020
62 Ga0207688_10015298 3300025901 Bacteria 4163
63 Ga0207693_10000955 3300025915 Bacteria 25933
64 Ga0207693_10025907 3300025915 Bacteria 4645
65 Ga0207649_10000003 3300025920 Bacteria 388908
66 Ga0207659_10000018 3300025926 Bacteria 156920
67 Ga0207687_10000015 3300025927 Bacteria 261701
68 Ga0207687_10000470 3300025927 Bacteria 27490
69 Ga0207687_10010242 3300025927 Bacteria 6125
70 Ga0207709_10002766 3300025935 Bacteria 10809
71 Ga0207670_10279356 3300025936 Bacteria 1301
72 Ga0207704_10000026 3300025938 Bacteria 123892
73 Ga0207691_10000002 3300025940 Bacteria 189785
74 Ga0207711_10000192 3300025941 Bacteria 65599
75 Ga0207661_10000235 3300025944 Bacteria 36349
76 Ga0207661_10000805 3300025944 Bacteria 20473
77 Ga0207661_10062212 3300025944 Bacteria 3019
78 Ga0207679_10018830 3300025945 Bacteria 4632
79 Ga0207677_10000308 3300026023 Bacteria 35929
80 Ga0207708_10334387 3300026075 Unclassified 1239
81 Ga0207702_10000337 3300026078 Bacteria 53931
82 Ga0207702_10004785 3300026078 Bacteria 11930
83 Ga0207676_10000025 3300026095 Bacteria 261714
84 Ga0207698_10000043 3300026142 Bacteria 96553
85 Ga0207428_10070494 3300027907 Bacteria 2747
86 Ga0207428_10076554 3300027907 Bacteria 2620
87 Ga0307410_10088905 3300031852 Bacteria 2188
88 Ga0307416_100117263 3300032002 Bacteria 2363
89 Ga0307415_100007127 3300032126 Bacteria 6089
90 Ga0395899_0062940 3300037312 Bacteria 2731
91 Ga0395900_0053589 3300037418 Bacteria 4152
92 Ga0395898_0002794 3300037466 Bacteria 20029
93 Ga0395898_0069003 3300037466 Bacteria 3421
94 Ga0395905_0234262 3300037471 Unclassified 1716
95 Ga0395901_0036581 3300038443 Bacteria 5075
96 Ga0395901_0066135 3300038443 Bacteria 3766
97 Ga0395901_0147426 3300038443 Bacteria 2473
98 Ga0395901_0151653 3300038443 Bacteria 2435
99 Ga0395901_0177066 3300038443 Bacteria 2237
100 Ga0395901_0549285 3300038443 Bacteria 1171
101 Ga0466963_0000318 3300044694 Bacteria 21719
102 Ga0466963_0003532 3300044694 Bacteria 8970
103 Ga0466957_0000692 3300044842 Bacteria 17208
104 Ga0466960_0294286 3300044901 Bacteria 913
105 Ga0466959_0040653 3300045049 Bacteria 3435
106 Ga0466959_0148597 3300045049 Bacteria 1653
107 Ga0466958_0012880 3300045836 Bacteria 4748
108 Ga0466958_0072712 3300045836 Bacteria 2106
109 Ga0466967_0000002 3300045976 Bacteria 219994
110 Ga0466967_0049164 3300045976 Bacteria 3687
111 Ga0466967_0199949 3300045976 Bacteria 1892
112 Ga0495621_0000872 3300046539 Bacteria 7702
113 Ga0495679_026423 3300047446 Bacteria 1928
114 Ga0496100_0058797 3300048903 Bacteria 2524
115 Ga0496101_0039455 3300048904 Bacteria 3358
116 Ga0496102_0004663 3300048905 Bacteria 11599
117 Ga0496103_0011223 3300048906 Bacteria 5306
118 Ga0496105_0004344 3300048908 Bacteria 10677
119 Ga0496106_0010173 3300048909 Bacteria 6949
120 Ga0496107_0009787 3300048910 Bacteria 6647
121 Ga0496108_0000005 3300048911 Bacteria 535059
122 Ga0496108_0005702 3300048911 Bacteria 10082
123 Ga0496108_0014921 3300048911 Bacteria 6342
124 Ga0496108_0048379 3300048911 Bacteria 3555
125 Ga0496109_0000002 3300048912 Bacteria 443393
126 Ga0496109_0000066 3300048912 Bacteria 112004
127 Ga0496109_0052594 3300048912 Bacteria 3712
128 Ga0496111_0021494 3300048914 Bacteria 4507
129 Ga0496113_0012288 3300048916 Bacteria 5750
130 Ga0496113_0061954 3300048916 Bacteria 2824
131 Ga0496114_0018561 3300048917 Bacteria 5625
132 Ga0496115_0000596 3300048918 Bacteria 27656
133 Ga0501042_0011734 3300049578 Bacteria 5920
134 Ga0501072_0025895 3300049588 Bacteria 4570
135 Ga0501075_0002117 3300049591 Bacteria 13132
136 nmdc:mga0yw44_30646_c1 3300050492 Bacteria 3120
137 nmdc:mga05p37_520636_c1 3300050507 Bacteria 1361
138 nmdc:mga05p37_72621_c1 3300050507 Bacteria 4234
139 nmdc:mga09592_1706_c1 3300050508 Bacteria 17700
140 nmdc:mga0qj67_4742_c1 3300050509 Bacteria 9878
141 nmdc:mga06r32_23809_c1 3300050510 Bacteria 5673
142 nmdc:mga06r32_75261_c1 3300050510 Bacteria 3276
143 nmdc:mga06r32_8994_c1 3300050510 Bacteria 8999
144 nmdc:mga08y16_17971_c1 3300050511 Bacteria 7449
145 nmdc:mga08y16_57631_c1 3300050511 Bacteria 4059
146 nmdc:mga0n895_31663_c1 3300050512 Bacteria 5067
147 nmdc:mga0a205_219550_c1 3300050515 Bacteria 1787
148 nmdc:mga0a205_4_c1 3300050515 Bacteria 168154
149 Ga0495601_0078601 3300053077 Bacteria 2114

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006852 Ga0075433_10042306 Ga0075433_100423062 275
2 3300038443 Ga0395901_0177066 Ga0395901_0177066_740_1588 275
3 3300044901 Ga0466960_0294286 Ga0466960_0294286_59_898 275
4 3300050515 nmdc:mga0a205_4_c1 nmdc:mga0a205_4_c1_155485_156336 275
5 3300025935 Ga0207709_10002766 Ga0207709_100027666 289
6 3300045049 Ga0466959_0148597 Ga0466959_0148597_558_1553 290
7 3300045836 Ga0466958_0012880 Ga0466958_0012880_1931_2926 290
8 3300045976 Ga0466967_0049164 Ga0466967_0049164_2263_3222 291
9 3300005344 Ga0070661_100000004 Ga0070661_10000000485 292
10 3300025920 Ga0207649_10000003 Ga0207649_10000003174 292
11 3300038443 Ga0395901_0147426 Ga0395901_0147426_520_1422 292
12 3300049578 Ga0501042_0011734 Ga0501042_0011734_2684_3589 292
13 3300005339 Ga0070660_100362175 Ga0070660_1003621752 294
14 3300005340 Ga0070689_100212715 Ga0070689_1002127151 294
15 3300005366 Ga0070659_100055636 Ga0070659_1000556365 294
16 3300005543 Ga0070672_100000049 Ga0070672_10000004951 294
17 3300009148 Ga0105243_10006741 Ga0105243_1000674110 294
18 3300011119 Ga0105246_10057811 Ga0105246_100578112 294
19 3300025936 Ga0207670_10279356 Ga0207670_102793562 294
20 3300025940 Ga0207691_10000002 Ga0207691_1000000267 294
21 3300048911 Ga0496108_0014921 Ga0496108_0014921_3428_4312 294
22 3300048912 Ga0496109_0000066 Ga0496109_0000066_97912_98796 294
23 3300049591 Ga0501075_0002117 Ga0501075_0002117_5115_6011 294
24 3300005329 Ga0070683_100021855 Ga0070683_1000218558 295
25 3300005365 Ga0070688_100000113 Ga0070688_10000011326 295
26 3300005466 Ga0070685_10000627 Ga0070685_100006272 295
27 3300005535 Ga0070684_100003218 Ga0070684_10000321810 295
28 3300005564 Ga0070664_100052445 Ga0070664_1000524454 295
29 3300006175 Ga0070712_100003550 Ga0070712_1000035506 295
30 3300006846 Ga0075430_100151544 Ga0075430_1001515442 295
31 3300006847 Ga0075431_100169680 Ga0075431_1001696802 295
32 3300009094 Ga0111539_10132402 Ga0111539_101324022 295
33 3300025915 Ga0207693_10000955 Ga0207693_1000095517 295
34 3300025944 Ga0207661_10000235 Ga0207661_100002353 295
35 3300025945 Ga0207679_10018830 Ga0207679_100188304 295
36 3300027907 Ga0207428_10070494 Ga0207428_100704942 295
37 3300045049 Ga0466959_0040653 Ga0466959_0040653_421_1404 295
38 3300050507 nmdc:mga05p37_520636_c1 nmdc:mga05p37_520636_c1_436_1332 295
39 3300050510 nmdc:mga06r32_75261_c1 nmdc:mga06r32_75261_c1_1361_2257 295
40 3300050511 nmdc:mga08y16_57631_c1 nmdc:mga08y16_57631_c1_1982_2878 295
41 3300045836 Ga0466958_0072712 Ga0466958_0072712_346_1242 296
42 3300005329 Ga0070683_100000855 Ga0070683_10000085521 297
43 3300005354 Ga0070675_100000078 Ga0070675_10000007849 297
44 3300005365 Ga0070688_100000271 Ga0070688_1000002712 297
45 3300005466 Ga0070685_10000012 Ga0070685_1000001284 297
46 3300005535 Ga0070684_100070922 Ga0070684_1000709224 297
47 3300005539 Ga0068853_100112381 Ga0068853_1001123813 297
48 3300005614 Ga0068856_100013015 Ga0068856_1000130154 297
49 3300005614 Ga0068856_100025853 Ga0068856_1000258537 297
50 3300006881 Ga0068865_100000061 Ga0068865_10000006122 297
51 3300009098 Ga0105245_10000023 Ga0105245_1000002366 297
52 3300009177 Ga0105248_10000245 Ga0105248_1000024522 297
53 3300013102 Ga0157371_10001441 Ga0157371_1000144119 297
54 3300013104 Ga0157370_10096668 Ga0157370_100966683 297
55 3300013105 Ga0157369_10000014 Ga0157369_10000014260 297
56 3300013297 Ga0157378_10085619 Ga0157378_100856195 297
57 3300025926 Ga0207659_10000018 Ga0207659_1000001889 297
58 3300025927 Ga0207687_10000015 Ga0207687_10000015116 297
59 3300025938 Ga0207704_10000026 Ga0207704_1000002619 297
60 3300025941 Ga0207711_10000192 Ga0207711_1000019222 297
61 3300025944 Ga0207661_10000805 Ga0207661_1000080521 297
62 3300026078 Ga0207702_10000337 Ga0207702_100003372 297
63 3300026078 Ga0207702_10004785 Ga0207702_100047858 297
64 3300026142 Ga0207698_10000043 Ga0207698_1000004350 297
65 3300032126 Ga0307415_100007127 Ga0307415_1000071276 297
66 3300044842 Ga0466957_0000692 Ga0466957_0000692_7140_8039 297
67 3300045976 Ga0466967_0000002 Ga0466967_0000002_212012_212911 297
68 3300048911 Ga0496108_0000005 Ga0496108_0000005_231981_232880 297
69 3300048911 Ga0496108_0005702 Ga0496108_0005702_6123_7019 297
70 3300048912 Ga0496109_0000002 Ga0496109_0000002_302212_303111 297
71 3300048916 Ga0496113_0061954 Ga0496113_0061954_1173_2072 297
72 3300049588 Ga0501072_0025895 Ga0501072_0025895_3589_4488 297
73 3300053077 Ga0495601_0078601 Ga0495601_0078601_792_1691 297
74 3300009147 Ga0114129_10081954 Ga0114129_100819545 298
75 3300038443 Ga0395901_0066135 Ga0395901_0066135_160_1077 298
76 3300044694 Ga0466963_0000318 Ga0466963_0000318_2346_3245 298
77 3300045976 Ga0466967_0199949 Ga0466967_0199949_596_1522 298
78 3300005981 Ga0081538_10009071 Ga0081538_100090717 299
79 3300047446 Ga0495679_026423 Ga0495679_026423_197_1252 299
80 3300005981 Ga0081538_10001950 Ga0081538_100019508 300
81 3300005981 Ga0081538_10009134 Ga0081538_100091342 300
82 3300046539 Ga0495621_0000872 Ga0495621_0000872_5312_6247 300
83 3300048916 Ga0496113_0012288 Ga0496113_0012288_4697_5632 300
84 3300005329 Ga0070683_100022176 Ga0070683_1000221761 301
85 3300005333 Ga0070677_10000016 Ga0070677_1000001635 301
86 3300005535 Ga0070684_100015887 Ga0070684_1000158876 301
87 3300006844 Ga0075428_100000315 Ga0075428_10000031541 301
88 3300009098 Ga0105245_10000049 Ga0105245_1000004957 301
89 3300025893 Ga0207682_10000008 Ga0207682_1000000897 301
90 3300025927 Ga0207687_10000470 Ga0207687_100004704 301
91 3300025944 Ga0207661_10062212 Ga0207661_100622125 301
92 3300050508 nmdc:mga09592_1706_c1 nmdc:mga09592_1706_c1_3158_4099 301
93 3300050509 nmdc:mga0qj67_4742_c1 nmdc:mga0qj67_4742_c1_3863_4804 301
94 3300050510 nmdc:mga06r32_23809_c1 nmdc:mga06r32_23809_c1_4357_5298 301
95 3300005338 Ga0068868_100003834 Ga0068868_1000038344 302
96 3300005338 Ga0068868_100167772 Ga0068868_1001677722 302
97 3300005343 Ga0070687_100106575 Ga0070687_1001065752 302
98 3300005364 Ga0070673_100075304 Ga0070673_1000753044 302
99 3300005441 Ga0070700_100304249 Ga0070700_1003042491 302
100 3300005466 Ga0070685_10077151 Ga0070685_100771511 302
101 3300005544 Ga0070686_100041550 Ga0070686_1000415502 302
102 3300005616 Ga0068852_100000022 Ga0068852_10000002274 302
103 3300005937 Ga0081455_10003113 Ga0081455_1000311317 302
104 3300005983 Ga0081540_1003574 Ga0081540_10035746 302
105 3300006038 Ga0075365_10013772 Ga0075365_100137723 302
106 3300006844 Ga0075428_100098081 Ga0075428_1000980813 302
107 3300006847 Ga0075431_100000083 Ga0075431_1000000832 302
108 3300006871 Ga0075434_100042078 Ga0075434_1000420783 302
109 3300009094 Ga0111539_10083466 Ga0111539_100834662 302
110 3300009098 Ga0105245_10005504 Ga0105245_1000550411 302
111 3300025901 Ga0207688_10015298 Ga0207688_100152982 302
112 3300025915 Ga0207693_10025907 Ga0207693_100259072 302
113 3300025927 Ga0207687_10010242 Ga0207687_100102422 302
114 3300026023 Ga0207677_10000308 Ga0207677_1000030823 302
115 3300026075 Ga0207708_10334387 Ga0207708_103343871 302
116 3300027907 Ga0207428_10076554 Ga0207428_100765543 302
117 3300031852 Ga0307410_10088905 Ga0307410_100889052 302
118 3300032002 Ga0307416_100117263 Ga0307416_1001172632 302
119 3300037312 Ga0395899_0062940 Ga0395899_0062940_224_1165 302
120 3300037418 Ga0395900_0053589 Ga0395900_0053589_3082_4023 302
121 3300037466 Ga0395898_0002794 Ga0395898_0002794_15502_16443 302
122 3300037466 Ga0395898_0069003 Ga0395898_0069003_838_1779 302
123 3300037471 Ga0395905_0234262 Ga0395905_0234262_143_1084 302
124 3300038443 Ga0395901_0036581 Ga0395901_0036581_1871_2812 302
125 3300038443 Ga0395901_0151653 Ga0395901_0151653_1252_2193 302
126 3300038443 Ga0395901_0549285 Ga0395901_0549285_55_1005 302
127 3300044694 Ga0466963_0003532 Ga0466963_0003532_4913_5851 302
128 3300048903 Ga0496100_0058797 Ga0496100_0058797_1489_2430 302
129 3300048904 Ga0496101_0039455 Ga0496101_0039455_323_1264 302
130 3300048905 Ga0496102_0004663 Ga0496102_0004663_10154_11095 302
131 3300048906 Ga0496103_0011223 Ga0496103_0011223_4056_4997 302
132 3300048908 Ga0496105_0004344 Ga0496105_0004344_1687_2628 302
133 3300048909 Ga0496106_0010173 Ga0496106_0010173_505_1446 302
134 3300048910 Ga0496107_0009787 Ga0496107_0009787_4827_5768 302
135 3300048911 Ga0496108_0048379 Ga0496108_0048379_223_1164 302
136 3300048912 Ga0496109_0052594 Ga0496109_0052594_795_1736 302
137 3300048914 Ga0496111_0021494 Ga0496111_0021494_2833_3774 302
138 3300048917 Ga0496114_0018561 Ga0496114_0018561_2901_3842 302
139 3300048918 Ga0496115_0000596 Ga0496115_0000596_10892_11833 302
140 3300050492 nmdc:mga0yw44_30646_c1 nmdc:mga0yw44_30646_c1_1231_2172 302
141 3300050507 nmdc:mga05p37_72621_c1 nmdc:mga05p37_72621_c1_16_957 302
142 3300050510 nmdc:mga06r32_8994_c1 nmdc:mga06r32_8994_c1_1481_2422 302
143 3300050511 nmdc:mga08y16_17971_c1 nmdc:mga08y16_17971_c1_3598_4539 302
144 3300050512 nmdc:mga0n895_31663_c1 nmdc:mga0n895_31663_c1_1953_2894 302
145 3300050515 nmdc:mga0a205_219550_c1 nmdc:mga0a205_219550_c1_516_1457 302
146 3300001977 JGI24746J21847_1002088 JGI24746J21847_10020884 303
147 3300003322 rootL2_10271559 rootL2_102715591 303
148 3300005618 Ga0068864_100000023 Ga0068864_100000023185 303
149 3300026095 Ga0207676_10000025 Ga0207676_1000002593 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13469

Sulfotransfer_3

Sulfotransferase family

64

285

0.82

PF00685

Sulfotransfer_1

Sulfotransferase domain

61

341

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cjm-assembly1.cif.gz_A human sult1a3 with sulfate bound 0.7013 9 294
5x2b-assembly10.cif.gz_J crystal structure of mouse sulfotransferase sult7a1 complexed with pap 0.6908 9 289
2ad1-assembly1.cif.gz_A human sulfotransferase sult1c2 0.6805 115 283
3ap3-assembly1.cif.gz_A crystal structure of human tyrosylprotein sulfotransferase-2 complexed with pap 0.6799 11 299
3ap3-assembly1.cif.gz_B crystal structure of human tyrosylprotein sulfotransferase-2 complexed with pap 0.6743 11 295
ID Description Score Start End Superfamily
af_Q4D429_2_214_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7193 125 291 3.40.50.300
af_A0A0N7KTJ7_26_270_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7017 125 294 3.40.50.300
1cjmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7013 9 294 3.40.50.300
af_A0A1D6KZE7_172_314_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6826 197 294 3.40.50.300
5x2bJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.655 2 289 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7J9YPW6-F1-model_v4 Sulfotransferase 0.962 1 299
AF-A0A7J9YPW6-F1-model_v4 Sulfotransferase 0.9466 1 299
AF-A0A6J5ZBR2-F1-model_v4 Unannotated protein 0.9387 9 293 GO:0001517
GO:0006044
GO:0006790
GO:0140096
AF-A0A6J5ZBR2-F1-model_v4 Unannotated protein 0.9168 9 293 GO:0001517
GO:0006044
GO:0006790
GO:0140096
AF-A0A538A6K8-F1-model_v4 Sulfotransferase domain-containing protein 0.8951 101 299 GO:0016740

Feature Viewer

pLDDT pTM Quality
88.84 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map